Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category

sermorelin buy online

All sermorelin buy online wholesalers & sermorelin buy online manufacturers come from members. We doesn't provide sermorelin buy online products or service, please contact them directly and verify their companies info carefully.

Total 468 products from sermorelin buy online Manufactures & Suppliers
Quality  for sale

Brand Name:steriodshow

Model Number:Sermorelin Acetate CAS 86168-78-7

Place of Origin:china manufactuer

...Sermorelin Acetate Cas No.: 86168-78-7 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Quality  for sale

Brand Name:Blue Dragon

Model Number:Sermorelin 2mg

Place of Origin:China Manufacturer

...99% Sermorelin 2mg 86168-78-7 GHRH (1-29) Anti Aging Weight Loss Body Wellness 1, Sermorelin Profile: Product Name: Sermorelin Specification: 2mg per vial Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2; GHRH (1-29) CAS: 86168-78...

Zhuhaishi Shuangbojie Technology Co., Ltd.
Verified Supplier

Guangdong

Quality  for sale

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

... Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was...

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

Quality  for sale

Brand Name:wumeitech

Model Number:200mg/ml

Place of Origin:China

...buy semi-finished injectable steroids 1-test cyp 200mg /100ml online 1-test cyp Receipes 1-test cyp/Dihydroboldonone 200mg/ml: 2% BA 10% BB 10% Guiacol 75% of ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Quality  for sale

Brand Name:SENDI

Model Number:YC001

Place of Origin:CHINA

... SKYPE or WhatsApp.we can chat directly. I am online all the time.Skype:hxk@ycphar.com Whatsapp:+8618126147481 Sermorelin reviews Product Name Sermorelin Chemical Name Sermorelin Acetate,GRF 1-29, CAS Number 86168-78-7 Molecular...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Quality  for sale

Brand Name:Sermorelin Acetate

Model Number:86168-78-7

Place of Origin:China

...TOP 99% Releasing Hormone Peptide Sermorelin Acetate for Muscle Strength 86168-78-7 Sermorelin is a GHRH (growth hormone-releasing hormone) peptide analogue. Its peptide sequence is comprised of 29 ...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Quality  for sale

Brand Name:Yuancheng

Model Number:Dianabol 80mg/ml

Place of Origin:Wuhan,Hubei

Dbol 80mg/ml Injectable Anabolic Steroids Dianabol 80mg/ml Oil Based Dianabol 80 If you are interested in my products,please contact: nancypeng@ycphar.com skype:nancy7159 whatsApp:86-13357185418 Dianabol 80mg/ml recipe: Dianabol 250ml @ 80 mg/ml 20 gram ...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Quality  for sale

Brand Name:pharmlab

Model Number:58-22-0

Place of Origin:China

Steroid powder Testosterone Base for bodybuilder growth muscle What is Testosterone Base? Testosterone base belongs to a class of hormones known as androgen; in fact, this is a primary androgen hormone. Testosterone itself is a very powerful hormone, ...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Quality  for sale

Brand Name:ChineseHormone

Model Number:1045-69-8

Place of Origin:China

CAS 1045-69-8 Testosterone Acetate 99% Purity For Bodybuilding Muscle Growth White powder MF: C21H30O3 Testosterone Acetate is much faster acting than Enathate or Cypionate, and thus requires a more frequent injection schedule such as every day or every ...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Quality  for sale

Brand Name:NJBN

Model Number:57773-63-4

Place of Origin:MADE IN CHINA

...Triptorelin Acetate 57773-63-4 Bodybuilding Polypeptide Hormones Triptorelin 2mg Buy Online Quick Details for Triptorelin Product Name : Triptorelin Acetate Cas No.: 57773-63-4 Sequence: Glp-His-...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

Quality  for sale

Brand Name:Pharmagrade Steroids

Model Number:1165910-22-4

Place of Origin:China

LGD -4033 CAS 1165910-22-4 selective androgen receptor modulators sarms source for Muscle Gaining 1. LGD-4033 Basic info: CAS No: 1165910-22-4 Customized: Customized Suitable for: Elderly, Children, Adult Purity: >99% MOQ: 10gram Function: New Supplements...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Hubei

Quality  for sale

Brand Name:owen.steroid

Model Number:Lyophilized Powder In Vials / Pure Raw Powder No Vial

Place of Origin:China

Brmelanotice Woman Sex Human Growth Hormone Peptides , Growth Hormone Fragment PT-141 Product Details: Product Name Brmelanotice Also known as PT141, PT-141 (Brmelanotice) Appearance Freeze-Dried White Powder Standard Pharmaceutical Purity Not Lower Than ...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Quality  for sale

Categories:Raw Steroid Powders

Country/Region:china

...HomePeptidesSermorelin Steroids Online Peptides Sermorelin Steroids Online 0Share Model: steroid-85 1000 Kilogram in Stock Company Name: Shanghai MeiHua Certification: ISO9001, SGS, ...

Shang Hai MeiHua Pharmaceutical Co.,Ltd
ICP Remarked Supplier

Quality  for sale

Place of Origin:China, TaiZhou

Brand Name:hugerawyuki@hotmail.com

Model Number:live:hugerawyuki

...-2, Mgf, Melanotan Peptides Genuine Sermorelin GRF 1-29 NH2 Legit Sermorelin GRF 1-29 NH2 Order Sermorelin GRF 1-29 NH2 Buy Sermorelin GRF 1-29 NH2 Get Sermorelin GRF 1-29 NH2 Online Sermorelin GRF 1-29 NH2 Source Sermorelin GRF 1-29 NH2 Quick...

Hugeraw Health Technology Co.,Ltd
Active Member

Jiangsu

Quality  for sale

Categories:Online UPS Systems

Country/Region:china

... subscription fee, but players can purchase premium items to customize or accelerate gameplay.   Silk Road Online is noted for its "Triangular Conflict System" in which characters can select from the three...

www.gameim.com LLC.
ICP Remarked Supplier

Quality  for sale

Categories:Double Conversion Online UPS

Country/Region:china

...Online media buying is one of the most quickest, targeted traffic and sales you can receive to your ...

Marketing Ignite Co. Ltd
ICP Remarked Supplier

Quality  for sale

Brand Name:shucan

Model Number:86168-78-7

Place of Origin:SHANGHAI

... Building & Fat Loss Growth Hormone Raw Powder With 99% Purity Quick Details: Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS...

ShangHai ShuCan industrial co.. LTD
Active Member

Shanghai

Quality  for sale

Brand Name:RIPTROPIN

Model Number:Riptropin 100iu

Place of Origin:China

...Pure Riptropin 100iu hgh injections for sale online with high quality hgh sale for women Riptropin [rDNA origin] is a way to supply natural ...

Marvel Pharma Inc.
Active Member

Hunan

Quality  for sale

Brand Name:HKSJG

Model Number:BULKRAWS

Place of Origin:China

...Buy Injectable Oils Primobolan Methenolone Methenolone Acetate for Gaining Cutting Cycle Muscles Quick Detail: 1.Place of ...

HongKong Shijingu Technology Co.,Ltd
Active Member

Hongkong

Quality  for sale

Categories:3 Phase Online UPS

Telephone:+86-592-5365868

Country/Region:china

... acid. For more information OR other specifications of the products, please contact us. Send Enquiry Online This form is unable to receive your i

pharmaceutical company
ICP Remarked Supplier

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request