Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category
Home > Chemicals > Explosive >

Peptide Igf 1 Lr3

peptide igf 1 lr3

All peptide igf 1 lr3 wholesalers & peptide igf 1 lr3 manufacturers come from members. We doesn't provide peptide igf 1 lr3 products or service, please contact them directly and verify their companies info carefully.

Total 1822 products from peptide igf 1 lr3 Manufactures & Suppliers
Quality  for sale

Brand Name:Gear Steroids

Model Number:946870-92-4

Place of Origin:CHINA

...Injection Hormone Peptide Igf lr3 CAS 946870-92-4 for Hospital for Muscle Growth 1, Basic Information Model NO.: CAS 946870-92-4 ...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Quality  for sale

Brand Name:Bodybiological

Place of Origin:Hubei, China

...Injectable Human Growth Hormone Peptide IGF lR3-1 1000mcg/vial Long-R3 for Fatness Basic information: Product Name: IGTROPIN /IGF-1 lr3 Manufacturer: GenSci Laboratories, China. Substance: Insuline-like Growth Factor Package: 1000mcg/vial * 10vials/kit The...

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Quality  for sale

Brand Name:Hongkong Blue Universal

Model Number:946870-92-4

Place of Origin:China

... Peptides IGF Lr3 For Greatly Boosts Muscle Mass 946870-92-4 IGF --- Insulin-Like Growth Factors What is IGF1-LR3 ? IGF-1 is basically a polypeptide hormone that has the same some of the same molecular properties as insulin. IGF...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality  for sale

Brand Name:YC

Model Number:CAS: 125-69-9

Place of Origin:China

...IGF-LR3 Anti-aging Fat Loss IGF LR3 HGH Growth Hormone Supplements Wrinkle Remover for Women IGF-1Lr3 1mg/vial,10vials/kit 0.1mg/vial,10vials/kit 1. Payment & Shipping Terms: Packaging Details: Discreet ...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Quality  for sale

Brand Name:IGF LR3 -1

Model Number:IGF LR3 -1

Place of Origin:China

...IGF LR3 -1Growth Hormone Peptide Igf-1Lr3 Igf Lr CAS 946870-92-4 For Lean Muscles / Recovery IGF LR3 Description IGF-1 is basically a polypeptide hormone that has the same some of the same molecular properties as insulin. IGF dose actually...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Quality  for sale

Brand Name:Muscle Building

Model Number:946870-92-4

Place of Origin:China

...99% Purity IGF-1 lr3 the Anabolic Powerhouse for Bodybuilding Email: ling@chembj.com Skype: ling@chembj.com Whatsapp: 0086 181 0845 9329 What is IGF1-LR3 IGF-1 is basically a polypeptide hormone that has the...

Changsha Zhenxiang Biotechnology Co., Ltd.
Verified Supplier

Hunan

Quality  for sale

Brand Name:YUANYANG

Model Number:946870-92-4

Place of Origin:China

...Human Growth Hormone Peptides IGF-1 LR3 0.1 mg/vial CAS 946870-92-4 For Good Body Shape Abstract IGF-1Lr3 is basically a polypeptide hormone that has the same some of the same molecular properties ...

Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Quality  for sale

Brand Name:Shanghai Stero

Model Number:IGF

Place of Origin:China

...Muscle Gain Peptides IGF 1 LR3 Growth Hormone Peptides Muscle Enhancing Steroid Description: IGF1 LR3 is known for being a growth hormone. It has plenty of growth promoting effects and it ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Quality  for sale

Brand Name:ChineseHormone

Model Number:CAS 946870-92-4

Place of Origin:China

...HGH Peptides IGF 0.1mg / vial Recombinant Human LR3 IGF-I Protein High Purity Is determined by SDS-PAGE (>95%) and reverse phase HPLC (>90%). This is the purest commercially available recombinant human LR3 IGF-I (Figure 1). The high...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Quality  for sale

Brand Name:Biopro

Model Number:GHP-37

Place of Origin:China

...Hormone Peptides IGF -1 DES 1mg / vial Basic Info. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 7,372 Da Synonyms: IGF-1Des(1-3), Des1-3, Des 1-3, Des (1-3) Compound: Thr-Leu-Cys-Gly-Ala. Purity: 99.21% IGF-1DES...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

Quality  for sale

Brand Name:Pharmlab

Model Number:IGF-1 LR3

Place of Origin:China

...Human Growth Hormone Peptide IGF-1 LR3 1mg For Natural Muscle Growth Quick detial Product name: IGF-1Lr3 Appearance:White lyophilized powder Specification: 1mg/vial Packing:10vials per kits Catagory: Human Growth Hormone Peptide There was...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Quality  for sale

Brand Name:Muscle

Model Number:CAS: 946870-92-4

Place of Origin:China

...White Powder Research Peptides Igf-1 Lr3 Bodybuilding IGF-1 LR3 by Lab For Adult With GMP IGF-1 LR3 Quick Detail: Product name:IGF-1Lr3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Storage:Dry Cool Place ...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Quality  for sale

Brand Name:HKYC

Model Number:946870-92-4

Place of Origin:China

...HGH Growth Hormone IGF LR3 Peptides 1mg / vial 0.1mg / vial Anti aging Fat Loss Wrinkle Remover Quick Details Product name:IGF-1 LR3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Storage:Dry Cool...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Quality  for sale

Brand Name:huao

Model Number:946870-92-4

Place of Origin:China

...Bodybuilding Human Growth Peptides IGF-1 LR3 Insulin Like Growth Factor LONG R3 IGF-1 Basic Info. Product name: IGF-1Lr3 Synonyms: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, CAS No.: 946870-92...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Quality  for sale

Brand Name:Nanjian

Model Number:946870-92-4

Place of Origin:China

...Pharmaceutical grade 99% Injection Hormone Peptide IGF-1 LR3 CAS 946870-92-4 for Muscle Growth Basic Information Model NO.: CAS 946870-92-4 Customized: Customized ...

Tai'an Jia Ye Biological Technology Co.,Ltd
Verified Supplier

Quality  for sale

Brand Name:Skype: rdy705

Model Number:ycwlb045@yccreate.com

Place of Origin:China

...Amino Acid Peptides IGF-1 LR3 for Increased Biological Activity CAS 946870-92-4 WHAT IS IGF-1 LR3? IGF-1 LR3, also known as Long Arg3 IGF-1, is a recombinant protein analogue of human Insulin-Like Growth Factor-1 that has a molar mass...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Quality  for sale

Place of Origin:China

Brand Name:IGF-LR3

... detailed info,please contact me at Email/MSN:alisa-hgh at hotmail.com Commodity Name:IGF-LR3HGH Specification:100mcg/vail,10vails/kit,1000mcg/kit Status:Brand new, expiration date in 3 years...

Please input your companyname!
Site Member

Hunan

Quality  for sale

Brand Name:N/A

Model Number:IGF-1 LR3

Place of Origin:China

...Bodybuilding Peptide IGF-1 LR3 in vials security delivery GMP PeptidesTop Quality njection Igf lr3 Product Description IGF-1 LR3, also known as Long-Arginine-3-IGF-1, is an analogue of human IGF-1 that has been modified to include a 13 amino acid...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Quality  for sale

Brand Name:Shucan

Model Number:221231-10-3

Place of Origin:China

... Peptides IGF -1LR3 For Growth Promoting IGF-1LR3 Basic Info: Product name IGF-1Lr3 CAS No. 946870-92-4 Purity 95% Appearance White powder Storage Dry Cool Place Specification 1mg/vial Introductation : What is IGF1-LR3 IGF...

Shanghai Shucan Industrial Co.,Ltd
Active Member

Shanghai

Quality  for sale

Brand Name:Demeikai

Model Number:CAS:946870-92-4

Place of Origin:wuhan

... powder Suitable for:Adult State:Solid Form:Powder Color:White Type:API IGF-1LR3 Dosage What is the dosage for IGF-1LR3 Dose per injection: 50 mcg Injections per vial: 20 x 50...

Wuhan Demeikai Biotechnology Co., Ltd
Active Member

Hubei

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request