Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category
Home > Chemicals > Chemical Reagents >

Natures Building Blocks

natures building blocks

All natures building blocks wholesalers & natures building blocks manufacturers come from members. We doesn't provide natures building blocks products or service, please contact them directly and verify their companies info carefully.

Total 7664 products from natures building blocks Manufactures & Suppliers
Quality Natural Anti Estrogen Supplements Anastrozole / Arimidex Steroid CAS 120511-73-1 for sale

Brand Name:YUANHANG

Model Number:120511-73-1

Place of Origin:CHINA

Anastrozole China Factory Supply Raw Material Arimidex Anti Estrogen Steroids Powder CAS 120511-73-1 Anastrozole Properties Melting point: 81-82°C storage temp. Store at RT solubility DMSO: soluble40mg/mL InChIKey YBBLVLTVTVSKRW-UHFFFAOYSA-N Safety ...

Yuanhang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Quality Muscle Building Primobolan Steroid Maintaining Muscle Extremely Effective for sale

Brand Name:HW Primobolan Steroid

Model Number:58-22-0 Primobolan Steroid

Place of Origin:CHINA

...Muscle Building Primobolan Steroid Methenolone Acetate Powder 434-05-9 Methenolone Acetate Powder Description: Methenolone Acetate is the ...

Shenzhen Haiwen Bio-Technology Co.,Ltd
Verified Supplier

Guangdong

Quality Role Play DIY Building Blocks Educational Toys 162Pcs Mini Farm 4 In 1 Combo Set for sale

Brand Name:Man Yuk

Model Number:1802, 1803, 1804, 1805

Place of Origin:China

...162Pcs ABS Plastic Mini Farm DIY Building Blocks Educational Toys 4 In 1 Combo Set Introductions: This is a farm located in a green mountain valley with beautiful scenery. There are natural pastures, clear river and happy...

Man Yuk Toys Co., Ltd
Verified Supplier

Guangdong

Quality Dormitory Mobile Container Homes , Steel Shipping Container For Moving House for sale

Brand Name:KAYI

Model Number:KAYI-MOBCH-11

Place of Origin:Hebei, China

... Container Homes With Dormitory For House-Building Product Introduction Overpopulation and migration have become symbols of modern life, and how many people are left homeless by natural disasters. In short, the traditional...

Hebei Kayi Building Material Technology Co.,LTD
Verified Supplier

Hebei

Quality CAS 521-12-0 Raw Muscle Building Anabolic Steroids Masteron Drostanolone Propionate for sale

Brand Name:Muscle Building Steroids

Model Number:CAS: 521-12-0

Place of Origin:China

...CAS 521-12-0 Raw Muscle Building Anabolic Steroids Masteron Drostanolone Propionate Detailed Product Profile: Product name: Testosterone Propionate Chemical Name: 4-Androsten-...

HK Globle Sino Ocean Dev. Co., Limited
Verified Supplier

Hong Kong

Quality Autoclave Light Weight Flyash Sand Cement Concrete Block Making Machine 380/415/440V for sale

Brand Name:WD

Model Number:AAC

Place of Origin:Henan,China(Mainland)

...Concrete Retaining Walls Autoclave Light Weight Flyash Sand Concrete Blocks Making Machine Manufacturer Introduction Areated concrete block (light block ) is the light and porous buidling material. It has light keeping temperature cant burn...

WANGDA Machinery Factory
Verified Supplier

Henan

Quality ACVR2B 1mg Polypeptide Hormone Myostatin Inhibitor ACE 031 For Building Musclea for sale

Brand Name:HKYC

Model Number:ACE-031

Place of Origin:China

About ACE-031 Description: 40.5 kDa protein containing 368 amino acid residues of the ActRIIb-hFc recombinant protein. MDAMKRGLCCVLLLCGAVFVSPGASGRGEAETRECIYYNANWELERTN QSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQEC ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Quality CAS 57-85-2 Muscle Building Steroids Testosterone Propionate White Powder for sale

Brand Name:Keray

Model Number:57-85-2

Place of Origin:China

Test Prop Quality Training Powder Testosterone Propionate Product Description 99% Quality Training Powder Testosterone Propionate Product details: Product name: Testosterone Propionate Chemical Name: 4-Androsten-17beta-ol-3-one propionate Other name: Test...

Shenzhen Keray Biotech Co., Ltd.
Verified Supplier

Guangdong

Quality L Glutamic Acid Amino Acid Powder Natural Nutrition Enhancement 56-86-0 for sale

Brand Name:No

Model Number:Food Grade

Place of Origin:China

Product Name L-Glutamic acid CAS number 56-86-0 Molecular formula C5H9NO4 Molecular weight 147.13 Appearance powder Melting point 205 °C FEMA 3285 Relative density 1.538 Introduction Glutamic Acid is the original source of L-glutamic acid. L-glutamic ...

Yi Da Chemical CO.LTD
Verified Supplier

Jiangsu

Quality Natural Male Enhancement Supplements Vardenafil Levitra Steroid powder for sale

Brand Name:HKYC

Model Number:HKYC

Place of Origin:HUBEI,CHINA

...Natural Male Enhancement Supplements Vardenafil Levitra Steroid powder Product Details: Product Name: Vardenafil Vardenafil Alias: Fardenafil, ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality A572 primary steel element for Environmentally friendly building for Oman for sale

Brand Name:HTG STEEL

Model Number:13-216

Place of Origin:Shandong, China

... Oman 1. Trust us and give the job to us. Our reputation of offering the strongest building in the market at an economical price sets Worldwide apart from the competition. With a combined...

Shandong Yijiehongfeng Energy Equipment Co., Ltd
Verified Supplier

Shandong

Quality Nano Inorganic Anti UV Masterbatch With Anti Aging Performance For Building Material for sale

Brand Name:NANOLINKE

Model Number:Anti-UV

Place of Origin:SHANGHAI CHINA

... Masterbatch Application Effective anti-aging performance Extending the service life of products Widely used in building materials, daily necessities, outdoor products, furniture, textiles, light boards, sunshade appliance, etc.; According to customer...

Shanghai Nalinke Materials Co.Ltd
Verified Supplier

Shanghai

Quality Legal Hormone Powder Trenbolone Acetate for Muscle Building Steroids 5630-53-5 for sale

Brand Name:wumeitech

Model Number:5630-53-5

Place of Origin:China

...Legal Hormone Powder Tibolone Acetate for Muscle Building Steroids 5630-53-5 Tibolone Acetate Details Product Name: Tibolone Acetate Synonyms: LIVIELLA; LIVIAL CAS: 5630-...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Quality White Powder Muscle Building Steroids Dehydroisoandrosterone DHEA CAS 53-43-0 for sale

Brand Name:Bodybuilding

Model Number:CAS No.:53-43-0

Place of Origin:China

...White Powder Muscle Building Steroids Dehydroisoandrosterone DHEA CAS 53-43-0 for Muscle Gain ******We are a leading raw steroid powders ...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Quality Anastrozole Arimidex Bodybuilding / Anti Estrogen Natural Aromatase Inhibitors Bodybuilding for sale

Brand Name:LANDMARK

Model Number:HPLC verfied

Place of Origin:CHINA

...Muscle Building Post Cycle Therapy Steroid Anastrozloe Anti Estrogen Products details: Product name: Arimidex CAS : 120511-73-1 ...

Landmark Nutraceuticals Co., Limited
Verified Supplier

Hongkong

Quality Raw Fluoxymesterone Muscle Building Steroids For Bulking Cycle CAS 76-43-7 for sale

Brand Name:Info@desen-nutrition.com

Model Number:CAS 76-43-7

Place of Origin:China

Fluoxymesterone (trade name Halotestin) is an anabolic steroid with strong androgenic properties that has been used in the treatment of male hypogonadism, delayed puberty in males, and in the treatment of breast neoplasms in women. Fluoxymesterone is ...

Hengyang Desen Biotechnology Co., Ltd.
Verified Supplier

Hunan

Quality Food Grade White Pure Nature Beeswax Block/Slabs for sale

Brand Name:Super-Sweet

Model Number:SS1001

Place of Origin:Henan, China (Mainland)

...China factory natural yellow beewax balock/broad Details pure nature beeswax block 1.100% nature 2.iso, fda standard 3.over 20 years experience 4.long-term, steady supply pure nature beeswax block we are one of the leading manufacturer...

Henan Super-Sweet Imp.&Exp. Trading Co., Ltd
Site Member

Henan

Quality Logo Printed Building Blocks Toys for sale

Categories:Children Wooden Building Blocks

Telephone:86-755-84536436

Country/Region:china

...Building Blocks with Wooden box Hotest Intelligent promotional gift Widely Popular games Classic Favorable wooden toys Key words: balance game Intelligent toys stacking block promotional gifts Toys wooden gifts PY0702-A 63pcs Three colors Building Blocks...

Shenzhen Creature Creation Toys Co., Ltd.
Active Member

Guangdong

Quality Best Ocean Animal Blocks Educational Designed Drums Beech Children Wooden Building Blocks for sale

Place of Origin:Hangzhou

Brand Name:Kundi

Model Number:1306

... Blocks Educational Designed Drums Beech Children Wooden Building Blocks Description: This section blocks finish environmental protection, working good, feeling fine, special packaging designed drums to facilitate the admission. You can build castleson...

Hangzhou Kundi Trading CO.,LTD
Active Member

Zhejiang

Quality Building blocks for sale

Place of Origin:Zhejiaing

Model Number:BT2030

...building blocks Shape Sorting Castle. A beautiful variation of a well-loved classic, this is the ultimate shape sorter! It features 9 chunky, vibrant colored shapes that make a satisfying clink as they drop into the natural...

BST Toys & Gifts Co., Ltd
Active Member

Zhejiang

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request