Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category
Home > Chemicals > Carbon Black >

Igf Lr3 Injection Sites

igf lr3 injection sites

All igf lr3 injection sites wholesalers & igf lr3 injection sites manufacturers come from members. We doesn't provide igf lr3 injection sites products or service, please contact them directly and verify their companies info carefully.

Total 140 products from igf lr3 injection sites Manufactures & Suppliers
Buy cheap Injectable HGH Steroid Human peptides Insulin - Like Growth Factor-I LR3 1mg / vial IGF LR3 product

Brand Name:HongKong Blue

Model Number:946870-92-4

Place of Origin:China

Injectable HGH Steroid Human peptides Insulin-Like Growth Factor-I LR3 1mg / vial IGF LR3 Product Details : Manufactured HongKong Blue Unit Size 1mg Appearance Lyophilized White ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Buy cheap Injectable Original Human Growth Insulin-Like Growth Factor 1 Peptides IGF Lr3 product

Brand Name:Gear-steroids

Model Number:IGF

Place of Origin:China

Injectable Original Human Growth Insulin-Like Growth Factor 1 Peptides IGF Lr3 Basic Info. Product name:Igf lr3 Apprience:Freeze-dried Powde Specification:1mg/vial;0.1mg/vial MOQ...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Buy cheap White Crystalline Powder Peptide Igf 1 Lr3 For Anti Aging 946870-92-4 product

Brand Name:Guangzhou Huao

Model Number:946870-92-4

Place of Origin:Guangzhou China

Human Growth Peptides 1mg/Vial Igf 1lr3 Cycle for Fat Loss CAS 946870-92-4 IGF-1 LR3--IGF-1 LR3 other name: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, ...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Buy cheap Gonadorelin Metastatic Castration Resistant Prostate Cancer Injection Treatment product

Brand Name:Fulu

Model Number:33515-09-2

Place of Origin:China

Gonadorelin Metastatic Castration Resistant Prostate Cancer Injection Treatment Gonadorelin Details Gonadorelin CAS: 33515-09-2 Gonadorelin MF: C55H75N17O13 Gonadorelin MW: 1182.29 ...

SuZhou FuLu Biotech Co.,Ltd
Verified Supplier

Jiangsu

Buy cheap Sell 98% Muscle Building Growth Hormone Peptides IGF-1 LR3 Insulin - Like Growth Factor product

Brand Name:kafen

Model Number:946870-92-4

Place of Origin:China

1 . Quick Details: Product name IGF-1Lr3 CAS No. 946870-92-4 Purity 95% Appearance White powder Storage Dry Cool Place Specification 1mg/vial 2 . Product Description: IGF-1 is ...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Buy cheap Human Growth Hormone Peptide IGF-1 LR3 1mg , Natural Muscle Growth Hormone Peptide product

Brand Name:Pharmlab

Model Number:IGF-1 LR3

Place of Origin:China

Human Growth Hormone Peptide IGF-1 LR3 1mg For Natural Muscle Growth Quick detial Product name: IGF-1Lr3 Appearance:White lyophilized powder Specification: 1mg/vial Packing:10vials ...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Buy cheap IGF-1 LR3 1mg Vials(0.1mg/Vials) Injection Peptides with Safe Shipping for Bodybuilder product

Brand Name:Sendi

Model Number:IGF-1 LR3

Place of Origin:China

IGF-1 LR3 1mg Vials Injection Peptides with Safe Shipping for Bodybuilder Product Information Name IGF-1 LR3 CAS 946870-92-4 Purity 98%min Appearance White powder Grade Medicine ...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap Bodybuilding Prohormone Supplements IGF - 1Lr3 Polypeptide IG - F1 DES product

Brand Name:PURITY

Place of Origin:china

GMP factory Supply IGF-1lr3 Polypeptide Igf-1 Igf des for Bodybuilding Product Description What is IGF-1Lr3 IGF-1Lr3 is basically a polypeptide hormone that has the same some of ...

Zhuzhou Yuancheng Hezhong Technology Development Co., Ltd.
Verified Supplier

Hunan

Buy cheap Good Effective Hormone Growth PolyPeptides Long R3 IGF - 1 Muscle Hyperplasia product

Brand Name:Shanghai Stero

Model Number:Long R3 IGF - 1

Place of Origin:China

Good Effective Hormone Growth PolyPeptides Long R3 IGF - 1 Muscle Hyperplasia What is IGF1 - LR3 Long R3 IGF-1 is a more potent version of IGF-1. It's chemically altered i like to ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Buy cheap CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 product

Brand Name:ChineseHormone

Model Number:IGF-1 DES

Place of Origin:China

Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 IGF-I Des(1-3) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain ...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Buy cheap MGF Injectable Peptide Steroids Human Growth Hormone 51022-70-9 product

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

MGF Injectable Peptide Steroids Human Growth Hormone 51022-70-9 MGF (Mechano Growth Factor) Mechano Growth Factor, better known as MGF, is a splice variant of Insulin-Like Growth ...

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

Buy cheap GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial product

Brand Name:Biopro

Model Number:GHP-37

Place of Origin:China

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial Basic Info. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molar ...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

Buy cheap 99% Pharmaceutical Intermediate Peptide 1mg/Vial Igf-1lr3 CAS 946870-92-4 product

Brand Name:simeiquan

Model Number:CAS: 946870-92-4

Place of Origin:China

Pharmaceutical Intermediate Peptide 1mg/Vial Igf-1lr3 CAS No. 946870-92-4 Product information: Product name:IGF-1 Lr3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder ...

Shenzhen Simeiquan Biotechnology Co., Ltd.
Verified Supplier

Guangdong

Buy cheap Pure Follistatin 344 Peptide Hormones Bodybuilding FS344 Strong Muscle Gains Injection product

Brand Name:wumeitech

Model Number:Follistatin 344 vials or Follistatin 344 Powder API

Place of Origin:China

Pure Follistatin 344 Peptide Hormones Bodybuilding FS344 Strong Muscle Gains Injection Product Name Follistatin 344 Also known as Follistatin 344, FS344 Appearance White Freeze...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Buy cheap Lab Research Human Growth Peptides IGF -1LR3 For Growth Promoting product

Brand Name:Shucan

Model Number:221231-10-3

Place of Origin:China

Lab Research Human Growth Peptides IGF -1LR3 For Growth Promoting IGF-1LR3 Basic Info: Product name IGF-1Lr3 CAS No. 946870-92-4 Purity 95% Appearance White powder Storage Dry Cool ...

Shanghai Shucan Industrial Co.,Ltd
Verified Supplier

Shanghai

Buy cheap IGF -1 LR3 0.1mg Growth Hormone Peptides Bodybuilding LONG R3 IGF1 LR3 IGF1 Purity 95% product

Brand Name:IGF-1 LR3 peptides

Model Number:IGF-1 LR3 Lyophilized Powder In Vials / Pure Raw Powder No Vial

Place of Origin:China IGF-1 LR3

IGF -1 LR3 0.1mg Growth Hormone Peptides Bodybuilding LONG R3 IGF1 LR3 IGF1 Purity 95% Product Name IGF-1 LR3 Also known as R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap Insulin-like growth factor 1mg IGF-1 LR3 Bodybuilding fast muscle growth bulk 100 % delivery product

Brand Name:IGF-1 LR3

Model Number:N/A

Place of Origin:China

Insulin-like growth factor 1mg IGF-1 LR3 fast muscle growth bulk 100 % delivery IGF-1 (Insulin-like growth factor) is an endocrine hormone that is produced in the liver. The ...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Buy cheap Recombinant Human Growth Hormone For Injection Hygetropin Black Tops / Yellow Top Hygiene Hyge HGH product

Brand Name:Hygene Biopharm

Model Number:Hygetropin 8iu

Place of Origin:China

Recombinant human growth hormone for Injection hygetropin black tops vs yellow top hygiene hyge hgh Q1: yellow top hyges vs. black and green top hyges First of let me say that I am ...

Marvel Pharma Inc.
Active Member

Hunan

Buy cheap IGF DES 1 - 3 Weight Loss Peptides For Bodybuilding Frozen Dry Powder product

Categories:Gazebos & Canopies

Country/Region:china

IGF DES 1 - 3 Weight Loss Peptides For Bodybuilding Frozen Dry Powder Large Image IGF DES 1 - 3 Weight Loss Peptides For Bodybuilding Frozen Dry Powder Product Details: Place of ...

Shanghai Stero Co,. Ltd
ICP Remarked Supplier

Buy cheap Injection Peptides IGF-1lr3 with Customzied for bodybuliser product

Categories:Other Furniture Parts

Telephone:+86-027-50458986

Country/Region:china

Injection Peptides IGF-1lr3 with Customzied for bodybuliser :Peptides :619 :2017-03-30 LR3 prevents glucose from entering into cells, which, in turn, forces the body to burn fat ...

Wuhan Demeikai Biotechnology Co.,Ltd
ICP Remarked Supplier

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request