Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category
Home > Chemicals > Carbon Black >

Igf 1 Lr3 Injection Sites

igf 1 lr3 injection sites

All igf 1 lr3 injection sites wholesalers & igf 1 lr3 injection sites manufacturers come from members. We doesn't provide igf 1 lr3 injection sites products or service, please contact them directly and verify their companies info carefully.

Total 117 products from igf 1 lr3 injection sites Manufactures & Suppliers
Buy cheap Injectable HGH Steroid Human peptides Insulin - Like Growth Factor-I LR3 1mg / vial IGF LR3 product

Brand Name:HongKong Blue

Model Number:946870-92-4

Place of Origin:China

Injectable HGH Steroid Human peptides Insulin-Like Growth Factor-I LR3 1mg / vial IGF LR3 Product Details : Manufactured HongKong Blue Unit Size 1mg Appearance Lyophilized White ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Buy cheap Gonadorelin Metastatic Castration Resistant Prostate Cancer Injection Treatment product

Brand Name:Fulu

Model Number:33515-09-2

Place of Origin:China

Gonadorelin Metastatic Castration Resistant Prostate Cancer Injection Treatment Gonadorelin Details Gonadorelin CAS: 33515-09-2 Gonadorelin MF: C55H75N17O13 Gonadorelin MW: 1182.29 ...

SuZhou FuLu Biotech Co.,Ltd
Verified Supplier

Jiangsu

Buy cheap MGF Injectable Peptide Steroids Human Growth Hormone 51022-70-9 product

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

MGF Injectable Peptide Steroids Human Growth Hormone 51022-70-9 MGF (Mechano Growth Factor) Mechano Growth Factor, better known as MGF, is a splice variant of Insulin-Like Growth ...

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

Buy cheap GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial product

Brand Name:Biopro

Model Number:GHP-37

Place of Origin:China

GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial Basic Info. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molar ...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

Buy cheap IGF DES 1 - 3 Weight Loss Peptides For Bodybuilding Frozen Dry Powder product

Brand Name:Shanghai Stero

Model Number:IGF DES 1 - 3

Place of Origin:China

IGF DES 1 - 3 Growth Hormone Petides Bodybuilding Peptides Mass Growing IGF-1 DES DES IGF-1 is a shorter version of the IGF-1 circuit. It is five (5) times more powerful than the ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Buy cheap IGF-1 LR3 1mg Vials(0.1mg/Vials) Injection Peptides with Safe Shipping for Bodybuilder product

Brand Name:Sendi

Model Number:IGF-1 LR3

Place of Origin:China

IGF-1 LR3 1mg Vials Injection Peptides with Safe Shipping for Bodybuilder Product Information Name IGF-1 LR3 CAS 946870-92-4 Purity 98%min Appearance White powder Grade Medicine ...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap Bodybuilding Human Growth Peptides IGF-1 LR3 Insulin Like Growth Factor LONG R3 IGF-1 product

Brand Name:huao

Model Number:946870-92-4

Place of Origin:China

Bodybuilding Human Growth Peptides IGF-1 LR3 Insulin Like Growth Factor LONG R3 IGF-1 Basic Info. Product name: IGF-1Lr3 Synonyms: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, ...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Buy cheap CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 product

Brand Name:ChineseHormone

Model Number:IGF-1 DES

Place of Origin:China

Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 IGF-I Des(1-3) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain ...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Buy cheap 99% Pharmaceutical Intermediate Peptide 1mg/Vial Igf-1lr3 CAS 946870-92-4 product

Brand Name:simeiquan

Model Number:CAS: 946870-92-4

Place of Origin:China

Pharmaceutical Intermediate Peptide 1mg/Vial Igf-1lr3 CAS No. 946870-92-4 Product information: Product name:IGF-1 Lr3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder ...

Shenzhen Simeiquan Biotechnology Co., Ltd.
Verified Supplier

Guangdong

Buy cheap Pure Follistatin 344 Peptide Hormones Bodybuilding FS344 Strong Muscle Gains Injection product

Brand Name:wumeitech

Model Number:Follistatin 344 vials or Follistatin 344 Powder API

Place of Origin:China

Pure Follistatin 344 Peptide Hormones Bodybuilding FS344 Strong Muscle Gains Injection Product Name Follistatin 344 Also known as Follistatin 344, FS344 Appearance White Freeze...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Buy cheap Lab Research Human Growth Peptides IGF -1LR3 For Growth Promoting product

Brand Name:Shucan

Model Number:221231-10-3

Place of Origin:China

Lab Research Human Growth Peptides IGF -1LR3 For Growth Promoting IGF-1LR3 Basic Info: Product name IGF-1Lr3 CAS No. 946870-92-4 Purity 95% Appearance White powder Storage Dry Cool ...

Shanghai Shucan Industrial Co.,Ltd
Verified Supplier

Shanghai

Buy cheap IGF -1 LR3 0.1mg Growth Hormone Peptides Bodybuilding LONG R3 IGF1 LR3 IGF1 Purity 95% product

Brand Name:IGF-1 LR3 peptides

Model Number:IGF-1 LR3 Lyophilized Powder In Vials / Pure Raw Powder No Vial

Place of Origin:China IGF-1 LR3

IGF -1 LR3 0.1mg Growth Hormone Peptides Bodybuilding LONG R3 IGF1 LR3 IGF1 Purity 95% Product Name IGF-1 LR3 Also known as R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap Methyl Synephrine HCl/Synephrine hydrochloride Fat-Burning Steroid Hormone product

Brand Name:HKYC

Model Number:99%

Place of Origin:CHINA

Basic Info. Synonyms: 1-(4-Hydroxyphenyl)-2-(methylamino)-ethanol hydrochloride Molecular Formula: C9H13NO2.HCl Molecular Weight: 203.67 CAS No.: 5985-28-4 Purity: 99% Appearance: ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Buy cheap CJC-1295 With DAC Dosage Safe Anti Aging Hormones Acetate Growth Hormone product

Brand Name:hksteroids.net

Model Number:863288-34-0

Place of Origin:China

CAS:863288-34-0 2mg/vial CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hongkong

Buy cheap Recombinant Human Growth Hormone For Injection Hygetropin Black Tops / Yellow Top Hygiene Hyge HGH product

Brand Name:Hygene Biopharm

Model Number:Hygetropin 8iu

Place of Origin:China

Recombinant human growth hormone for Injection hygetropin black tops vs yellow top hygiene hyge hgh Q1: yellow top hyges vs. black and green top hyges First of let me say that I am ...

Marvel Pharma Inc.
Active Member

Hunan

Buy cheap IGF-1 LR3 Bodybuilding DES Insulin-like growth factor 1mg strong workout supplements product

Brand Name:IGF-1 LR3

Model Number:N/A

Place of Origin:China

IGF-1 DES Insulin-like growth factor 1mg fast muscle growth bulk 100 % delivery IGF-1 (Insulin-like growth factor) is an endocrine hormone that is produced in the liver. The ...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Buy cheap Peptides 99% purity Injection Peptides IGF-1lr3 5mg/vial 10vials/kit for muscle builder white powder  CAS:946870-92-4 product

Brand Name:Demeikai

Model Number:CAS:946870-92-4

Place of Origin:wuhan

Product name:IGF-1Lr3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Storage:Dry Cool Place Grade:Medicine Grad Specification:5mg/vial or 10 mg/vial Supply Ability:1000 ...

Please input your companyname!
Site Member

Buy cheap Injection Peptides IGF-1lr3 with Customzied for bodybuliser product

Categories:Other Furniture Parts

Telephone:+86-027-50458986

Country/Region:china

Injection Peptides IGF-1lr3 with Customzied for bodybuliser :Peptides :619 :2017-03-30 LR3 prevents glucose from entering into cells, which, in turn, forces the body to burn fat ...

Wuhan Demeikai Biotechnology Co.,Ltd
ICP Remarked Supplier

Buy cheap Kigtropin Hgh product

Place of Origin:china

Brand Name:Real kigtropin

Model Number:kigtropin-03

Inquiry and order email: superhgh02 at live.com Product name: Kigtropin HGH Price:70-110$/kit(order more, better price) MOQ:1 Kit Specification: 100iu/kit (10iu/vial, 10vial/Kit) ...

Super Human Growth Hormone Pharmaceutical Co.,Ltd
Active Member

Guangdong

Buy cheap Kigtropin 10iu product

Place of Origin:China

Brand Name:Real kigtropin

Model Number:Kigtropin-02

Inquiry and order email: superhgh02 at live.com Product name: Kigtropin HGH Price: 70-110$/kit(order more, better price) MOQ: 1 Kit Specification: 100iu/kit (10iu/vial, 10vial/Kit) ...

Super Human Growth Hormone Pharmaceutical Co.,Ltd
Active Member

Guangdong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request