Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category

hormones 2

All hormones 2 wholesalers & hormones 2 manufacturers come from members. We doesn't provide hormones 2 products or service, please contact them directly and verify their companies info carefully.

Total 67196 products from hormones 2 Manufactures & Suppliers
Buy cheap Muscle Building Raw Hormone Powders Prohormone Steroids Halodrol Turinadiol product

Brand Name:Yuancheng

Model Number:NA

Place of Origin:China

High Quality Muscle Building Prohormone Steroids Halodrol Turinadiol Product Name:Halodrol,Halovar Alias:Halodrol 50,H-drol,Halo-V,halostane,Halo-test ,4-Chloro,Chlorodehydromethyl...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Buy cheap Miconazole Nitrate Antifungal Pharma Raw Materials , Raw Hormone Powders CAS 22832-87-7 product

Brand Name:FuLu

Model Number:C18H15Cl4N3O4

Place of Origin:China

Miconazole Nitrate Antifungal Pharma Raw Materials , Raw Hormone Powders CAS 22832-87-7 Miconazole nitrate Product Name: Miconazole nitrate Miconazole nitrate CAS: 22832-87-7 ...

SuZhou FuLu Biotech Co.,Ltd
Verified Supplier

Jiangsu

Buy cheap GHRP-6 Peptide Hormones Bodybuilding CAS 87616-84-0 , White Crystal powder product

Brand Name:LSW

Model Number:87616-84-0

Place of Origin:China

Top Quality GHRP-6 Bodybuilding Peptides CAS 87616-84-0 for Reducing Levels of Body Fat Quick Details: Product name:GHRP-6 Other name:GHRP-6 Acetate;His(1)-lys(6)-ghrp;GH-Releasing ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Buy cheap 99% Purity Sex Hormone Steroids 17 Alpha - Estradiol CAS 57-91-0 Estradiol Progestogen product

Brand Name:YIHAN

Model Number:17 Alpha -Estradiol

Place of Origin:China

99% Purity Sex Hormone Steroids 17 Alpha - Estradiol CAS 57-91-0 Estradiol Progestogen Product Description Products name 17alpha-Oestradiol CAS NO 57-91-0 Chemical Name epiestradia...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Buy cheap Tibolone Bodybuilding Prohormones Cutting Stack Female Hormones Medicines product

Brand Name:Yuancheng

Model Number:5630-53-5

Place of Origin:China

Tibolone Bodybuilding Prohormones Cutting Stack Female Hormones Medicines Quick Details: CAS: 5630-53-5 EINECS: 227-069-1 Assay: 99% min. MF: C21H28O2 MW: 312.45 Character: White ...

Wuhan Yuancheng Technology Development Co., Ltd.
Verified Supplier

Hubei

Buy cheap Healthy Fat Burning Hormones , Powder Orlistat Weight Loss Cas 96829-58-2 For Obesity product

Brand Name:Huao

Model Number:96829-58-2

Place of Origin:China

Product Description (Facebook:snow@yccreate.com) legit manufacturers Losing Weight Bodybuilding Orlistat Anabolic Steroids Basic Info. Orlistat CAS: 96829-58-2 Orlistat MF: ...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Buy cheap CAS 57773-63-4 Lyophilized Peptide Steroid Hormones GNRH Triptorelin Cancer Treatment product

Brand Name:Jiaye

Model Number:Wuhan2017022

Place of Origin:China

CAS 57773-63-4 Lyophilized Peptide Steroid Hormones GNRH Triptorelin Cancer Treatment Details: Product name: Triptorelin CAS: 57773-63-4 Chemical Names: TRIPTORELIN; Triptoreline; ...

Tai'an Jia Ye Biological Technology Co.,Ltd
Verified Supplier

Buy cheap 11-Oxo Prohormone Steroids Hormone Powder 11-Ketotestosterone CAS 382-45-6 Adrenosterone product

Brand Name:GC

Model Number:382-45-6

Place of Origin:China

1. Quick Detail: English name: adrenosterone Alias: androst-4-ene-3,11,17-trione CAS: 382-45-6 EINECS Number: 206-843-2 Formula: C19H24O3 MW: 300.3921 Molecular Structure: Density: ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Buy cheap CAS 12629-01-5 Muscle Building Injectable Anabolic Steroids Human Growth Hormone product

Brand Name:SR Health Tech

Model Number:12629-01-5

Place of Origin:China

Injectable Steroids 99% Purity Human Growth Hormone, HGH White Lyophilized Powder Muscle Building Steroids CAS No. 12629-01-5 Profile: Human growth hormone is a remarkable hormone. ...

Steroidraws Health Tech Company Limited
Verified Supplier

Hong Kong

Buy cheap Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 product

Brand Name:Shuangbojie

Model Number:nutrition@chembj.com

Place of Origin:China

Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap Steroid Hormone White powder Testosterone Isocaproate for Bodybuilding CAS 15262-86-9 product

Brand Name:JNJG

Model Number:15262-86-9

Place of Origin:CHINA

Steroid Hormone White powder Testosterone Isocaproate for Bodybuilding CAS 15262-86-9 Testosterone Isocapronate Quick Details: Product Name: Testosterone Isocapronate Testosterone ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Buy cheap Cas 58-22-0 Hormone Testosterone Base 100mg / Ml 200mg / Ml 250mg / Ml product

Brand Name:SENDI

Model Number:YC001

Place of Origin:CHINA

Product Information Product Name Testosterone base Synonym testex;testoderm;Testoviron;androlin;Android;testred; CAS Number 58-22-0 Molecular formula C19H28O2 Molecular weight 288...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap Testosterone Cypionate Powder SARMs steroids CAS 58-20-8 Test Cyp Hormone product

Brand Name:Biopro

Model Number:SARMS-19

Place of Origin:China

Testosterone Cypionate Powder SARMs steroids CAS 58-20-8 Test Cyp Hormone Description Testosterone cypionate is a slow-acting injectable ester of the basic male androgen testostero...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

Buy cheap Estradiol enantate chemical hormone CAS4956-37-0 WHITE STERIOD product

Place of Origin:CHINA

Brand Name:YC

Model Number:58-20-8

Estradiol enantate Appearance:White powder CAS: 4956-37-0 Molecular formula: C25H36O3 Molecular Weight: 384.55 1kg/Tin Skype: ycwlb012@yccreate.com QQ: 2355779415 Uses and Function ...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Buy cheap Steroid Hormone Testosterone Undecanoate 98% Purity CAS 5949-44-0 for Men's Sexual Function product

Brand Name:HZ

Model Number:CAS 5949-44-0

Place of Origin:China

Steroid Hormone Testosterone Undecanoate White Powder 98% Purity CAS 5949-44-0 Suitable for Men's Sexual Function Alias: Andriol CAS No: 5949-44-0 Purity: 99% MF: C30H48O3 MW: 456...

Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
Verified Supplier

Hubei

Buy cheap Injection Hormone Testosterone Anabolic Steroid / Testosterone Undecylate 5949-44-0 product

Brand Name:GB

Place of Origin:China

Testosterone Powder Testosterone Undecanoate 5949-44-0 injection hormone 1. Testosterone undecanoate or testosterone undecylate is an ester of testosterone which is used for the ...

Hubei God bull Pharmaceutical Co.,Ltd
Verified Supplier

Hubei

Buy cheap HGH powder injection 99.61% purity Kirotropin Human Growth Hormone 10iu/ vial product

Brand Name:Kirotropin

Model Number:HGH-191aa

Place of Origin:China

HGH powder injection 99.61% purity Kirotropin Human Growth Hormone 10iu/ vial Brand Name: Kirotropin Increased Muscle Mass & Enhanced muscle strength Weight loss & Improved ...

Shenzhen Ghormone Biotech Co.,Ltd
Verified Supplier

Guangdong

Buy cheap 10418-03-8 Oral Anabolic Steroids Winstrol Hormones , Cutting Cycle Steroids Stanozolol 50mg product

Brand Name:ChineseHormone

Model Number:CAS 10418-03-8

Place of Origin:China

10418-03-8 Oral Anabolic Steroids Winstrol Hormones , Cutting Cycle Steroids Stanozolol 50mg Hello,This is Jack from Chinese Biggest professional steroid hormones maunfacture. From ...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Buy cheap Anabolic Steroids Powder Muscle Growth White Powder Anabolic Steroids Hormone Boldenone Acetate product

Brand Name:Kafen

Model Number:2363-59-9

Place of Origin:China

Muscle Growth White Powder Anabolic Steroids Hormone Boldenone Acetate Basic Info. English Synonyms: Boldenone 17-acetate; 1, 4-ANDROSTADIEN-17B-OL-3-ONEACETATE; ANDROSTADIENOLONE ...

Please input your companyname!
Site Member

Buy cheap HGH , human growth hormone , hgh for sale , hgh injections, hormone , 10IU , forever-Inject.cc product

Brand Name:Forever-Inject.cc Online Store

Place of Origin:China

Product Information HGH Treatment as an Anti-Aging Drug. Hgh (Human growth hormone) has been called a miracle anti-aging drug. Hgh injections is an effective anti-ageing drug due ...

ForeverInject International Holdings CO. Limited
Site Member

Zhejiang

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request