Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category

hfc full form

All hfc full form wholesalers & hfc full form manufacturers come from members. We doesn't provide hfc full form products or service, please contact them directly and verify their companies info carefully.

Total 624 products from hfc full form Manufactures & Suppliers
Quality Hanging Hfc-227ea Extinguishing System with Electrical Actuator for sale

Brand Name:xingjin

Place of Origin:China

...Hanging Hfc-227ea Extinguishing System with Electrical Actuator Parameter: No. Specification Technical Parameter 1 Filling pressure 1.6Mpa 2 Spraying ...

Guangzhou Xingjin Fire Equipment Co.,Ltd.
Verified Supplier

Quality PⅢ 500 JCAM Trunk Cable Seamless Aluminum Tube for HFC Duplex Transmission Network for sale

Place of Origin:China

Brand Name:KINGTONE OR OEM

Model Number:Signal Coaxial Cable PⅢ 500 JCAM

...PⅢ 500 JCAM Trunk Cable Seamless AL Tube for HFC Duplex Transmission Network Quick Detail: Signal Coaxial Cable PⅢ 500 JCAM Trunk Cable 0.109 Inches /2....

KINGTONE ELECTRONICS CO.,LTD
Verified Supplier

Zhejiang

Quality High Purity HFC 32 Refrigerant Difluoromethane Replacement Of CH4 for sale

Brand Name:newradar

Model Number:N/A

Place of Origin:China

... Refrigerant Difluoromethane Replacement Of CH4 Description: Refrigerant Gas Difluoromethane, also called HFC-32 or R-32, is an organic compound of the dihalogenoalkane variety. It is based on ...

Wuhan Newradar Special Gas Co.,Ltd
Verified Supplier

Hubei

Quality G1 3/4'' Port Size Ammonia Refrigeration Solenoid Valves EVR40 Weight 3.902kg for sale

Brand Name:Brando

Model Number:EVR40

Place of Origin:CHINA

EVR40 G1 3/4'' Port Size Ammonia Refrigeration Solenoid Valves Weight 3.902kg The EVR40 ammonia refrigeration solenoid valve is made of corrosion-resistant, acid-resistant plastic box seals; the return spring device is arranged outside the fluid, which is...

Ningbo Brando Hardware Co., Ltd
Verified Supplier

Zhejiang

Quality Peptide Human Growth Hormone Peptide Ace 031 Powder 1mg/Vial ACE031 for Bodybuilder Muscle Growth for sale

Brand Name:YIHAN

Model Number:ACE 031

Place of Origin:China

...:Acvr2b, Activin Receptor Type Iib Introduce: Unit: 1mg/vial ,10vial/kit Synonyms:ACE-031, ActRIIb-hFc, ACVR2B, activin receptor type IIB and human immunoglobulin Fc region construct,

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Quality Parker Denison Hydraulic Pumps Axial Piston Pump PV016 PV020 PV023 PV028 Series for sale

Brand Name:Parker

Model Number:PV016R1K1T1NMR1 PV016R1K8T1NMMC PV020L1E1T1NMFC PV020R1K1T1NMM1 PV023R1K1B1NFFP PV028R1K1T1WMM1

Place of Origin:Germany

Parker PV Series Axial Piston Pump Technical Features Low noise level Fast response Service-friendly High self-priming speed Compact design Thru drive for 100% nominal torque PV 016 to 360 Features/Benefits: • Displacements from 16-360 cc/rev – covers...

Saar HK Electronic Limited
Verified Supplier

Shanghai

Quality ACVR2B 1mg Polypeptide Hormone Myostatin Inhibitor ACE 031 For Building Musclea for sale

Brand Name:HKYC

Model Number:ACE-031

Place of Origin:China

... acid residues of the ActRIIb-hFc recombinant protein. MDAMKRGLCCVLLLCGAVFVSPGASGRGEAETRECIYYNANWELERTN QSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQEC VATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTGGGTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Quality Maneurop Refrigeration Model MTZ22 - 5VI 1 Phase Piston Reciprocating Compressor for sale

Brand Name:Maneurop

Model Number:MTZ22-5VI

Place of Origin:France

Maneurop Refrigeration model MTZ22-5VI 1 phase Piston reciprocating compressor​ Product Description The Danfoss compressor range goes from small direct current hermetic compressors for mobile applications up to large scroll compressors for commercial ...

Shenzhen Ruifujie Technology Co., Ltd.
Verified Supplier

Guangdong

Quality Water Cooling Thermal Shock Test Chamber / Environmental Test Chambers for sale

Brand Name:KOMEG

Model Number:KTS-100A

Place of Origin:guangdong

.... At some point, this stress can exceed the strength of the material, causing a crack to form. If nothing stops this crack from

KOMEG Technology Ind Co., Limited
Verified Supplier

Guangdong

Quality Free Defrost Supermarket Island Freezer Merchandiser With Integral Compressor for sale

Brand Name:SINCOOL

Model Number:I7 OCEANUS

Place of Origin:CHINA

...: https://youtu.be/xAuyRo4F5xE) Our specially designed merchandisers are beneficial in every way, shape and form. Specially designed island merchandiser freezers give each store an appealing and unique look and view...

ANHUI SOCOOL REFRIGERATION CO., LTD.
Verified Supplier

Anhui

Quality 10g Japanese Chili Sauce Delicious for sale

Brand Name:TASSYA

Model Number:A0902-02

Place of Origin:China

... Sweet Chilli Sauce For Sushi Foods: Benefisha thai sweet chili sauce is traditionally brewed from HFCS,Food Additives (acetylated distarch phosphate, citric acid, lactic acid),Chilli. It is a staple condiment and...

Shanghai Benefisha Industrial Co., Ltd.
Verified Supplier

Shanghai

Quality PⅢ 500 JCAM Trunk Cable Seamless Aluminum Tube for HFC Duplex Transmission Network for sale

Brand Name:KINGTONE OR OEM

Model Number:Signal Coaxial Cable PⅢ 500 JCAM

Place of Origin:China

...PⅢ 500 JCAM Trunk Cable Seamless AL Tube for HFC Duplex Transmission Network Quick Detail: Signal Coaxial Cable PⅢ 500 JCAM Trunk Cable 0.109 Inches /2....

KINGTONE ELETRONICS CO.,LTD
Site Member

Shanxi

Quality HFC-23 extinguishing agent for sale

Place of Origin:Zhejiang

Model Number:HFC-23

... - Physical properties: Component Chemical name Molecular formula Weight% HFC-23 Trifluoromethane CHF3 100 Molecular weight Boiling point Critical temperature Critical pressure Odor Form Color Heat of vaporization at boiling point Vapor Pressure...

Zhejiang jiahui Industrial Co., Ltd.
Active Member

Zhejiang

Quality 1.0040AS20-A00-0-V,    R928005849,    Bosch Rexroth,    Filter element,    MobileHydraulics for sale

Brand Name:Rexroth

Model Number:1.0040AS20-A00-0-V

Place of Origin:Germany

1.0040AS20-A00-0-V, R928005849, Bosch Rexroth, Filter element, MobileHydraulics The filter element is the central component of industrial filters. The actual filtration process takes part in the filter element. The main filter variables, such as retention...

SAAR HK Electronic Limited
Site Member

Shanghai

Quality HFC Refrigerant GAS Environmental protection R404A Refrigerants for sale

Brand Name:GALAXY

Model Number:800KG 400KG;50LG 30LB 1000G 500G 350KG

Place of Origin:CHINA

...a (Suva HP62) environmental protection refrigerants Composition: HFC - 125 (44%), HFC - 134 - a (4%) and HFC - 143 - a (52%), type of HFC refrigerants, ODP value is zero, is the industry standard HFC refrigerant replacement R - 502. R - 404 - a is suitable...

HUIZHAN ENERGY MACHINERY CO., LTD
Active Member

Guangdong

Quality Colorless liquid 1,1,1,2,2,3-HEXAFLUOROPROPANE / HFC-236fa Cas 690-39-1 for sale

Brand Name:Zhonglan

Model Number:ZL

Place of Origin:China

.... Specification of Industrial Raw Materials 99.9% Colorless liquid HFC236fa used as Refrigerant English name: 1,1,1,2,2,3-HEXAFLUOROPROPANE;HFC-236fa CAS : 690-39-1 Content : 99.9% Item Specifications Results Appearance Colorless liquid Conform Content...

Zhonglan Industry Co., Ltd.
Active Member

Quality Carbides HfC for sale

Categories:Silicon Carbide Mechanical Seal

Telephone:0574-62681100

Country/Region:china

...HfC HfC Technical Parameters Model APS Purity(%) Specific surface (m2/g) Volume density (g/cm3) Density(g/cm3) Crystal form Color NO-C-011-1 800nm 99.9 15.9 3.41 12.7 hexagon black NO-C-011-2 3um 99.9 7.8 3.9 12...

Ningbo JinLei Nano Materials Technology Co., Ltd
ICP Remarked Supplier

Quality Hafnium Carbide HfC P for sale

Categories:Powder Metallurgy Parts

Telephone:86-0379-65112007

Country/Region:china

..., superfine hafnium carbide with many compounds (such as ZrC, TaC) form a solid solution. Properties: Appearance: Black Odorless Powder Molecular Formula: HfC Molar mass: 190.50 g/mol Molecular Weight: 103.2347 Melting Point...

Luoyang Tongrun Info Technology Co., Ltd
ICP Remarked Supplier

Quality Hafnium Carbide HfC Powder for sale

Categories:Powder Metallurgy Parts

Telephone:0086-0379-65112007

Country/Region:china

..., superfine hafnium carbide with many compounds (such as ZrC, TaC) form a solid solution. Properties: Appearance: Black Odorless Powder Molecular Formula: HfC Molar mass: 190.50 g/mol Molecular Weight: 103.2347 Melting Point...

uoyang Tongrun Info Technology Co., Ltd.
ICP Remarked Supplier

Quality Mixed Refrigerant Gas HFC-407 for sale

Place of Origin:China

Brand Name:cosutin

Model Number:R-407

... No. Typical Wt. % 1, 1, 1, 2-Tetrafluoroethane 811-97-2 52% Pentafluoroethane 354-33-6 25% Difluoromethane 75-10-5 23% Form Compressed liquefied gas Colour Colourless Odour Ether-like PH Neutral PKa Not applicable Melting point...

cosutin Industrial Co., Limited
Active Member

Guangdong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request