Sign In | Join Free | My
Search by Category
Home > Chemicals > Textile Chemicals >

Does Cjc 1295 Work

does cjc 1295 work

All does cjc 1295 work wholesalers & does cjc 1295 work manufacturers come from members. We doesn't provide does cjc 1295 work products or service, please contact them directly and verify their companies info carefully.

Total 2788 products from does cjc 1295 work Manufactures & Suppliers
Quality Muscle Building Protein Peptide Hormones Lyophilized Powder Cjc-1295 Dac with GMP for sale

Brand Name:Muscle Man

Model Number:863288-34-0

Place of Origin:Hunan,China

... Hormones Lyophilized Powder Cjc-1295 Dac with GMP For Muscle Building Product Quick Detail: Product Name CJC1295 with DAC Unit Size 2mg per vial CAS No. 863288-34-0 Synomyms CJC-1295 DAC, CJC 1295 with DAC...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier


Quality 2mg CJC 1295 without DAC CAS 863288-34-0 Peptide Steroid Hormones CJC 1295 White Powder for sale

Brand Name:Zhenxiang

Model Number:CAS: 863288-34-0

Place of Origin:CHINA

...2mg CJC 1295 without DAC CAS: 863288-34-0 Peptide Steroid Hormones CJC 1295 White Powder Quick Detail; Product name: CJC 1295 without DAC/ CJC 1295 DAC CAS: 863288-34-0 Formula: C152H252N44O42 Molecular weight: 3367.2 purity: > 98.0% Appearance: White...

Changsha Zhenxiang Biotechnology Co., Ltd.
Verified Supplier


Quality Human Growth Peptide Powder 2mg CJC-1295 without DAC For Bodybuilding for sale

Brand Name:JNJG

Model Number:863288-34-0

Place of Origin:CHINA

...Human Growth Peptide Powder 2mg CJC-1295 without DAC For Bodybuilding Quick Detail: Product Name CJC-1295 without DAC Synonym CJC-1295 Acetate; CJC1295 CAS 863288-34-0 MF C159H258N46O45 MW 3367.2 Appearance White lyophilized powder Purity...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier


Quality CJC-1295 Acetate Human Growth Peptides 98.0% white powder  863288-34-0 for sale

Brand Name:ChineseHormone

Model Number:863288-34-0

Place of Origin:China

...CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a releasing hormone (GHRH) analog. CJC-1295 Acetate Human Growth Peptides 98.0% white powder 863288-34-0 Description : One of the advantages of CJC-1295 over...

Verified Supplier

Hong Kong

Quality Peptide Hormones Bodybuilding GHRH CJC-1295 with DAC For Increases Protein Synthesis for sale

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

.../vial Cjc-1295 with Dac for Fat Burning 2mg/Vial Legal Safe Peptide CJC-1295 Acetate with Dac Muscle Growth Polypeptide Materials Human Growth Hormone Peptide Manufacturer Supply Cjc-1295 Without Dac with Over 98% Purity CJC-1295...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier


Quality 87616-84-0 Human Peptides CJC-1295 Freeze-dried Powder For  Muscle Gain for sale

Brand Name:Hongkong blue

Model Number:CJC-1295 87616-84-0

Place of Origin:CHINA

...87616-84-0 Human Peptides CJC-1295 Freeze-dried Powder For Muscle Gain Why choose hongkong blue company and contact mabel ? Emai:...

HongKong Blue Universal Co., Limited.
Verified Supplier


Quality 99.5% 2mg / Vial Peptide CJC-1295 Without DAC GHRH CAS 51753-57-2 Polypeptide Hormones For Losing Fat & Healthy Care for sale

Brand Name:pharm-china

Model Number:51753-57-2

Place of Origin:China

...99.5% 2mg/Vial Peptide CJC-1295 Without DAC GHRH CAS 51753-57-2 Polypeptide Hormones For Losing Fat & Healthy Care Basic View : CJC-1295 without DAC (2mg/Vial / 10vial/Kit) Sequence:Tyr-D-Ala-Asp-Ala...

Shanghai Yijing Pharmaceutical Co.,Ltd
Verified Supplier


Quality CJC1295 Without DAC High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial 863288-34-0 for sale

Brand Name:CJC-1295 Without DAC

Model Number:863288-34-0

Place of Origin:China

...High purity legal peptides Steroids CJC-1295 Without DAC​​​ 2mg / Vial , CAS 863288-34-0 Not only has Cjc1295 shown the ability to ...

JCJ Logis Co.,ltd
Verified Supplier


Quality CAS 863288-34-0 Human Growth Hormone Peptide with DAC 2mg CJC-1295 DAC for sale

Brand Name:Pharmlab

Model Number:863288-34-0

Place of Origin:China

...99% Human Growth Peptide CJC-1295 with DAC 2mg CAS 863288-34-0 for Muscle Growth CJC-1295 DAC Quick detail Product Name CJC-1295 With DAC CAS Number 863288-34-0 Molecular Formula C165H269N47O46 Molecular Weight 873...

Pharmlab Co.,Ltd
Verified Supplier


Quality CAS 863288-34-0 Peptides Steroids Powder Cjc-1295 No Dac for Muscle Enhance for sale

Brand Name:HKYC


Place of Origin:HUBEI,CHINA

...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial for sale

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial 1. CJC 1295 DOSES Modified GRF 1-29(cjc1295 w/o DAC): Dose per injection: 100mcg Injections per vial: 20 x 100mcg ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier


Quality CAS 51753-57-2 Human Growth Peptides Cjc-1295 with Dac 2mg / Vial for Weight Loss for sale

Brand Name:Gear Steroids

Model Number:51753-57-2

Place of Origin:China

... 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% MOQ: 1 kit Material: Pharmaceutical Raw Material Reship: Available Usage: for Lean Muscle Shipping Time: 3~7 Working days Specification: USP28 HS...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier


Quality CJC-1295 DAC Bodybuilding Supplements Increase GHRP Production Injection for sale

Brand Name:Grand Uni or OEM

Model Number:CAS:863288-34-0

Place of Origin:China

...-Ile-Leu-Ser-Arg-LysLys(Maleimidopropionyl)-NH2 (Drug Affinity Complex) CJC-1295 Molecular formula: C165H269N47O46 CJC-1295 Molar Mass: 3647.15 CJC-1295 CAS number: 863288-34-0 CJC-1295 is an injectable peptide used to increase GH production.

Verified Supplier


Quality Pure CJC-1295 Without DAC 2mg Growth Hormone Releasing Peptide Fat Loss for sale

Brand Name:Blue Dragon

Model Number:CJC-1295 (Without/ No DAC) 2mg

Place of Origin:China Manufacturer

...CJC-1295 (Without/ No DAC) Profile: Product Name: CJC-1295 Without DAC Specification: 2mg per vial Synonyms: CJC-1295 Acetate; CJC-1295; CJC-1295 No DAC, CJC-1295 W/O DAC, Modified GRF (1-29) CAS No.: 863288-34-0 MF: C152H252N44O42 MW: 3367.97 Sequence...

Zhuhaishi Shuangbojie Technology Co., Ltd.
Verified Supplier


Quality CJC 1295 Nutrition Fitness Peptide Growth Hormone 2mg / Vial CAS 863288-34-0 for sale

Brand Name:YIHAN

Model Number:CJC -1295

Place of Origin:China

...CJC 1295 Nutrition Fitness Peptide Growth Hormone 2mg / Vial CAS 863288-34-0 CJC-1295 Alias: CJC-1295 Acetate; CJC1295(Without DAC); Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-...

Yihan Industrial Co.,Ltd.
Verified Supplier


Quality Human Growth Peptides CJC-1295 Acetate cjc1295 DAC 2mg/vial,863288-34-0 for sale

Brand Name:YC

Model Number:863288-34-0

Place of Origin:China

... name: CJC-1295 Acetate Alias:GHRH, Growth Hormone Releasing Hormones,MOD GRF 1-29 CAS Registry Number: 863288-34-0 Appearance: White Powder Purity:98% Grade: Pharmaceutical Grade Storage: Shading, confined preservation CJC-1295 Effect CJC-1295 is...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier


Quality Bodybuilding Hormone Supplements Growth Hormone Peptides Injection CJC 1295 DAC for sale

Brand Name:Shanghai Stero

Model Number:CJC 1295 DAC

Place of Origin:China

...Bodybuilding Hormone Supplements Growth Hormone Peptides Injection CJC 1295 DAC Description: CJC-1295 with DAC is a peptide known to help in promoting muscle gain, muscle strength, lean body ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier


Quality CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production for sale


Model Number:863288-34-0

Place of Origin:MADE IN CHINA

...Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Quick Detail: Product Name CJC1295 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier


Quality Weight Loss Growth Hormone Peptides CJC 1295 CAS 863288340 5mg / Vial With DAC for sale

Brand Name:DW

Model Number:863288-34-0

Place of Origin:China

...Growth Hormone Peptides CJC -1295 5mg/vial With DAC For Muscle Building CAS 863288-34-0 1 . Quick Details: Product Name:CJC-1295 DAC Alias: CJC1295(GHRH/DAC) Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr...

Doublewin Biological Technology Co., Ltd.
Verified Supplier


Quality Purity 98% Injectable Anabolic Human Growth Bodybuliding Hormone Cjc-1295 (DAC) for sale

Brand Name:Nanjian

Model Number:Wuhan2017022

Place of Origin:China

...)-NH2 (Drug Affinity Complex) Molecular formula: C165H269N47O46 Molar Mass: 3647.15 CAS number: 863288-34-0 CJC-1295 is an injectable peptide used to increase GH production. This peptide is a growth hormone

Tai'an Jia Ye Biological Technology Co.,Ltd
Verified Supplier

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request