Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category
Home > Chemicals > Chemical Reagents >

Cjc Peptide Side Effects

cjc peptide side effects

All cjc peptide side effects wholesalers & cjc peptide side effects manufacturers come from members. We doesn't provide cjc peptide side effects products or service, please contact them directly and verify their companies info carefully.

Total 3388 products from cjc peptide side effects Manufactures & Suppliers
Buy cheap HPLC Hexarelin Muscle Building Peptides Most Effective 98 Percent Purity product

Brand Name:YUANYANG

Model Number:CAS: 140703-51-1

Place of Origin:CHINA

98% Purity (HPLC) Body Building Peptide Hexarelin (2mg/Vial) Desctiprion: Product Name: Hexarelin Synonyms: Examorelin CAS: 140703-51-1 MF: C47H58N12O6 MW: 887.04 Purity (HPLC): 98...

Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Buy cheap Ipamorelin Selective Anti Aging Growth Hormone Releasing Peptides Healthy Effect product

Brand Name:Yuancheng

Model Number:170851-70-4

Place of Origin:China

Ipamorelin Selective Anti Aging Human Growth Hormone HGH , Growth Hormone Releasing Peptides Ipamorelin Model NO.: 98 Specification: 2mg/Vial CAS No: 170851-70-4 Mf: C38h49n9o5 ...

Wuhan Yuancheng Technology Development Co., Ltd.
Verified Supplier

Hubei

Buy cheap Human Growth Hormone CJC-1295 DAC (2mg/vial) CAS NO.863288-34-0 product

Brand Name:Simeiquan

Model Number:863288-34-0

Place of Origin:China

Human Growth Hormone CJC-1295 DAC (2mg/vial) CAS NO.863288-34-0 for Bodybuilding Quick Details ProName: CJC-1295 DAC (2mg/vial) CasNo: 863288-34-0 Appearance: white Application: ...

Shenzhen Simeiquan Biotechnology Co., Ltd.
Verified Supplier

Guangdong

Buy cheap Weight Loss CJC-1295 With DAC Human Peptides CJC-1295 Growth Hormone Releasing Hormone product

Brand Name:hongkong blue

Model Number:CJC-1295 With DAC 51753-57-2

Place of Origin:CHINA

Weight Loss CJC-1295 With DAC Human Peptides CJC-1295 Growth Hormone Releasing Hormone CJC-1295 DAC effects .....boost protein synthesis and fuel the growth of muscle tissue .........

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Buy cheap USP Peptide Hormones Bodybuilding CJC1295 CAS 863288-34-0 Purity 99% White Powder for Lean Body Mass product

Brand Name:LSW

Model Number:863288-34-0

Place of Origin:China

USP Human Growth Hormone Peptide CJC1295 CAS 863288-34-0 Purity 99% White Powder for Lean Body Mass CJC-1295 promotes lean body mass, muscle gain and strength. CJC 1295 is a long ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Buy cheap Peptide Steroid Hormones GMP Peptides Research Peptide Ghrp-6 Acetate 87616-84-0 product

Brand Name:YCGC

Model Number:Ghrp-6

Place of Origin:Wuhan, Hubei, China

Peptide Steroid Hormones GMP Peptides Research Peptide Ghrp-6 Acetate 87616-84-0 Basic Info Molecular weight: 873.01 Molar Mass: 873.014 Appearance: White lyophilized powder ...

Wuhan Yuancheng Gongchuang Technology Co., Ltd.
Verified Supplier

Hubei

Buy cheap Peptide Hormones Bodybuilding 2Mg / Vial Peptide DSIP White Powder product

Brand Name:Pharmagrade Steroids

Model Number:62568-57-4

Place of Origin:China

Peptide Hormones Bodybuilding 2Mg / Vial Peptide DSIP White Powder DSIP DSIP Unit Size :2 mg/vial DSIP Unit Quantity :1 Vial DSIP Purity: 99.0%min Delta sleep-inducing peptide(DSIP...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Buy cheap High Purity Pharmaceutical Polypeptide Hormones CJC-1295 with DAC product

Brand Name:CJC-1295 with DAC

Model Number:5mg/vial * 10vials/kit

Place of Origin:China

High Purity Pharmaceutical Polypeptide Hormones CJC-1295 with DAC Description: CJC-1295 DAC has shown some amazing results as a growth hormone releasing hormone (GHRH) analog. Not ...

HongKong Biosuper Health Tech. Co., Ltd
Verified Supplier

Hongkong

Buy cheap white powder 2 mg/vial  Peptide CJC 1295 Without DAC for muscle building 863288-34-0 product

Brand Name:JNJG

Model Number:863288-34-0

Place of Origin:CHINA

GHRH Human Growth Hormone Anabolic Steroid Peptides CJC 1295 Without DAC 2 mg/vial 863288-34-0 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; CJC-1295 Acetate;CJC1295 ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Buy cheap CAS 863288-34-0 High Purity Growth Hormone Peptides for Lean Body Mass , CJC1295 product

Brand Name:Biopro

Model Number:GHP-31

Place of Origin:China

CAS 863288-34-0 High Purity Growth Hormone Peptides for Lean Body Mass , CJC1295 CJC-1295 promotes lean body mass, muscle gain and strength. CJC 1295 is a long acting GHRH analog. ...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

Buy cheap 2Mg Injectable Pentadecapeptide BPC 157 Powder Peptides Steroids For Muscle Building product

Brand Name:SENDI

Model Number:YC001

Place of Origin:CHINA

Hello,This is Cherry from China.we offer Pentadecapeptide BPC 157 besides, we have offer GHRP peptide like GHRP-2;GHRP-6;ipamorelin;PEG-MGF;MGF if you are interested,plz contact me ...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap 99% Purity Muscle Building Steroids Peptide Delta sleep-inducing peptide(DSIP) CAS 62568-57-4 product

Brand Name:YIHAN

Model Number:DSIP

Place of Origin:China

99% Purity Muscle Building Steroids Peptide Delta sleep-inducing peptide(DSIP) Quick Detail: Product Name:Delta sleep-inducing peptide(DSIP) Specification: 1mg/vial or 2mg/vial; ...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Buy cheap High Purity Pharmaceutical Peptide Hormones Bodybuilding CJC-1295 with DAC product

Brand Name:CJC-1295 with DAC

Model Number:5mg/vial * 10vials/kit

Place of Origin:China

Description: CJC-1295 DAC has shown some amazing results as a growth hormone releasing hormone (GHRH) analog. Not only has CJC-1295 shown the ability to increase growth hormone and ...

HongKong Amgen Biopharm CO.,LTD
Verified Supplier

Hong Kong

Buy cheap Medicine Grade Polypeptide CJC-1295 with DAC 2mg/vial For Fat Burning product

Brand Name:rina@pharmade.com

Model Number:skype: zarazhou3

Place of Origin:China

Medicine Grade Polypeptide CJC-1295 with DAC 2mg/vial For Fat Burning Buy CJC-1295 with DAC Online from rina at pharmade dot com Density:1.45 CJC-1295 with DAC Product Description: ...

Shenzhen Shijingu Technology Co., Ltd.
Verified Supplier

Guangdong

Buy cheap CJC-1295 DAC Fat Loss Human Growth Hormone Muscle Gain 2 Mglvial product

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

CJC-1295 DAC Fat Loss Human Growth Hormone Muscle Gain 2 Mglvial CJC-1295 DAC CJC-1295 DAC has shown some amazing results as a growth hormone releasing hormone (GHRH) analog. Not ...

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

Buy cheap GHRP-6 Peptide Hormones Growth hormone releasing peptide 6 Benefits Daily Dose product

Brand Name:steriodshow

Model Number:GHRP-6 CAS 87616-84-0

Place of Origin:china manufactuer

GHRP-6 (Growth hormone releasing peptide) Alias: GROWTH HORMONE RELEASING PEPTIDE-6; [HIS1, LYS6]-GHRP; HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2; H-HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2 CAS: ...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap Long Acting Growth Hormone Peptide CJC-1295 Excluding DAC 863288-34-0 product

Brand Name:Simeiquan

Model Number:T-A004

Place of Origin:China

CJC-1295 Excluding DAC Basic Information Mode T-A003 Package 2mg/vial Molecular formula C165H269N47O46 Molar Mass 3647.15 CAS number 863288-34-0 This product should be applied ...

Shenzhen Simeiquan Biotechnology Co., Ltd.
Verified Supplier

Guangdong

Buy cheap White Powder PT-141 Brmelanotice 10mg / vial Peptide Side Effects product

Brand Name:Quanao Chemical

Model Number:PT-141 (Brmelanotice)

Place of Origin:China

PT-141 (Brmelanotice) for sale 10mg/vial online reviews PT 141 peptide side effects Quick Detail Brmelanotice ( PT-141 ) sterile lyophilized Peptide finished in 10ml/vial ...

Guangzhou Quanao Chemical Co.,Ltd
Active Member

Guangdong

Buy cheap PT-141 Brmelanotice Male Enhancement Powders 10mg/ Vial PT 141 Peptide Side Effects product

Brand Name:SMQ

Model Number:PT-141 (Brmelanotice)

Place of Origin:China mainland

PT-141 (Brmelanotice) for sale 10mg/vial online reviews PT 141 peptide side effects Quick Detail Brmelanotice ( PT-141 ) sterile lyophilized Peptide finished in 10ml/vial ...

Shenzhen Simeiquan Biotechnology Co., Ltd.
Active Member

Guangdong

Buy cheap GHRP-6 Growth hormone releasing peptide 6 for sale product

Categories:Food Trays

Telephone:+8618578209853

Country/Region:china

Buyer's Guide Lyophilized Peptides Home>>Lyophilized Peptides >>GHRP-6 Growth hormone releasing peptide 6 for sale GHRP-6 Growth hormone releasing peptide 6 for sale GHRP-6 (Growth ...

Zhuhaishi Shuangbojie Technology Co.,ltd
ICP Remarked Supplier

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request