Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category
Home > Chemicals > Chemical Reagents >

Cjc Peptide Side Effects

cjc peptide side effects

All cjc peptide side effects wholesalers & cjc peptide side effects manufacturers come from members. We doesn't provide cjc peptide side effects products or service, please contact them directly and verify their companies info carefully.

Total 3376 products from cjc peptide side effects Manufactures & Suppliers
Buy cheap 99% Purity white powder 2 mg/vial  Peptides CJC 1295 Without DAC for muscle building 863288-34-0 product

Brand Name:JNJG

Model Number:863288-34-0

Place of Origin:CHINA

GHRH Human Growth Hormone Anabolic Steroid Peptides CJC 1295 Without DAC 2 mg/vial 863288-34-0 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; CJC-1295 Acetate;CJC1295 ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Buy cheap 2mg Per vial Peptide CJC 1295 Without DAC Modified GRF 1-29 for Injection product

Brand Name:N/A

Place of Origin:China

2mg Per vial Peptide CJC 1295 Without DAC Modified GRF 1-29 for Injection CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone Releasing Hormones ...

Shenzhen Ghormone Biotech Co.,Ltd
Verified Supplier

Guangdong

Buy cheap Raw Human Growth Peptides , Medical Ghrp 2 For Women 221231-10-3 product

Brand Name:huao

Model Number:221231-10-3

Place of Origin:China

Human Growth Peptides 99 . 9 % GHRP-2 5mg/vial Muscle Gain and Anti Aging 1 . Quick Detail Product Name GHRP-2 (Pralmorelin) Apperance: White powder CAS NO.: 158861-67-7 Purity: 98...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Buy cheap PEG MGF 2Mg Per Vial HGH Human Growth Hormone Peptides PEG Mechano Growth Factor product

Brand Name:Jiaye

Model Number:2016-02-02

Place of Origin:China

PEG MGF 2Mg Per Vial HGH Human Growth Hormone Peptides PEG Mechano Growth Factor 1.PEG MGF (Pegylated Mechano Growth Factor) PEG MGF is a splice variant of the IGF produced by a ...

Tai'an Jia Ye Biological Technology Co.,Ltd
Verified Supplier

Buy cheap 99% White Thymosin Beta4 Acetate Peptide Hormones Bodybuilding product

Brand Name:LSW

Model Number:CAS:107761-42-2

Place of Origin:China

99% white Thymosin Alpha1 Acetate /Thymosin Beta4 Acetate /Tb500 2mg with fast delivery and reasonable price Description TB-500 is a synthetic fraction of the protein thymosin beta...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Buy cheap 99% Growth Hormone Peptides Bodybuilding GHRP -2 Pralmorelin 158861-67-7 Melanotan - II product

Brand Name:ChineseHormone

Model Number:CAS:158861-67-7

Place of Origin:China

GHRP-2 Pralmorelin 158861-67-7 Melanotan-II muscle bodybuilding healthcare Product Name:GHRP-2(5mg/vial or 10mg/vial) Synonyms:Pralmorelin;D-Alanyl-3-(2-naphthalenyl)-D-alanyl-L...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Buy cheap Fat Loss Lyophilized Peptide GHRP-6 CAS 87616-84-0 Peptide Growth Hormone product

Brand Name:Shuangbojie

Model Number:nutrition@chembj.com

Place of Origin:China

Polypeptide Lyophilized GHRP-6 CAS 87616-84-0 for Increased Fat Loss Product Name: Growth hormone releasing peptide Synonyms: sk&f110679;[D-TRP7, ALA8, D-PHE10]-ALPHA-MELANOCYTE ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap IGF -1 LR3 Human Growth Hormone Peptide For Muscling Building / Fat Loss , CAS 946870-92-4 product

Brand Name:YIHAN

Model Number:IGF-1 LR3

Place of Origin:CHINA

IGF -1 LR3 Human Growth Hormone Peptide For Muscling Building / Fat Loss , CAS 946870-92-4 Basic Info Of IGF-1 LR3: Product name: IGF-1Lr3 CAS No.: 946870-92-4 MF: C30H49N9O9 ...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Buy cheap Male / Female HGH Peptides Bremelanotide PT -141 10mg / vial CAS 189691-06-3 product

Brand Name:Biopro

Model Number:GHP-34

Place of Origin:China

Male / Female HGH Peptides Bremelanotide PT -141 10mg / vial CAS 189691-06-3 Description PT-141 (Bremelanotide)was developed from the peptide hormone melanotan II which underwent ...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

Buy cheap Effect synthetic anabolic steroids Melanotanii Melanotan2 Mt 2 / 121062-08-6 White Powder product

Brand Name:HZ

Model Number:121062-08-6

Place of Origin:Wuhan

Best Price Good Effect Melanotanii Melanotan2 Mt 2 / 121062-08-6 White Powder Melanotan 2, Melanotan, Mt II, MT2 Melanotan 2 (MT2)Melanotan-II CAS 121062-08-6 Purity (by HPLC): 99...

Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
Verified Supplier

Hubei

Buy cheap Effective Male Sex Hormones Yohimbine Hcl Supplement For Erectile Dysfunction product

Brand Name:Yuancheng

Model Number:Yuancheng

Place of Origin:Wuhan,Hubei

Erectile Dysfunction Treatment Powder Yohimbine HCl Male Sex Hormones Yohimbine HCl CAS No: 65-19-0 Yohimbine HCl Einecs No: 200-600-4 Yohimbine HCl MF: C21H27ClN2O3 Yohimbine HCl ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Buy cheap CAS 863288-34-0 Anti Aging CJC-1295 GH-Releasing Factor1-29 / HGRF1-29 product

Brand Name:CJC-1295

Model Number:863288-34-0

Place of Origin:China

CAS 863288-34-0 Anti Aging CJC-1295 GH-Releasing Factor1-29 / HGRF1-29 Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 ...

HongKong Amgen Biopharm CO.,LTD
Verified Supplier

Hong Kong

Buy cheap Peptides Bodybuilding 121062-08-6 Pentadecapeptide BPC 157 Lyophilized Powder product

Brand Name:Pharmagrade Steroids

Model Number:121062-08-6

Place of Origin:China

Peptides Bodybuilding 121062-08-6 Pentadecapeptide BPC 157 Lyophilized Powder pentadecapeptide BPC 157 Alias: Booly Protection Compound 15, Pentadecapeptide, BPC 157 CAS: 137525-51...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Buy cheap Peptides AOD-9604  Weight Loss Drug With No Side Effect CAS 221231-10-3 product

Brand Name:Fulu

Model Number:221231-10-3

Place of Origin:China

Peptides AOD-9604 Weight Loss Drug With No Side Effect CAS 221231-10-3 AOD-9604 Basic Info Item AOD9604 Unit Size 2mg/vial Appearance Lyophilized White Powder CAS NO. 221231-10-3 ...

SuZhou FuLu Biotech Co.,Ltd
Verified Supplier

Jiangsu

Buy cheap White Powder PT-141 Brmelanotice 10mg / vial Peptide Side Effects product

Brand Name:Quanao Chemical

Model Number:PT-141 (Brmelanotice)

Place of Origin:China

PT-141 (Brmelanotice) for sale 10mg/vial online reviews PT 141 peptide side effects Quick Detail Brmelanotice ( PT-141 ) sterile lyophilized Peptide finished in 10ml/vial ...

Guangzhou Quanao Chemical Co.,Ltd
Active Member

Guangdong

Buy cheap PT-141 Brmelanotice Male Enhancement Powders 10mg/ Vial PT 141 Peptide Side Effects product

Brand Name:SMQ

Model Number:PT-141 (Brmelanotice)

Place of Origin:China mainland

PT-141 (Brmelanotice) for sale 10mg/vial online reviews PT 141 peptide side effects Quick Detail Brmelanotice ( PT-141 ) sterile lyophilized Peptide finished in 10ml/vial ...

Shenzhen Simeiquan Biotechnology Co., Ltd.
Active Member

Guangdong

Buy cheap Polypeptides and HGH  Lose Stubborn Belly Fat Peptide Anabolic Peptide Cjc-1295 product

Brand Name:Kafen

Model Number:863288-34-00

Place of Origin:China

Lose Stubborn Belly Fat Peptide Anabolic Peptide Cjc-1295 Basic Information for CJC-1295 without DAC: Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, Neorelin, ...

Please input your companyname!
Site Member

Buy cheap CJC-1295 , peptide , 2mg , Synonyms : CJC1295 , MOD GRF 1-29 , cas 863288-34-0 product

Place of Origin:Forever-Inject.cc

Brand Name:Forever-Inject.cc Online Store

CJC-1295 2mg the other name MOD GRF 1-29 is a long acting GHRH analog for growth hormone.Various experiments have been conducted to test the effectiveness of CJC1295 in vivo and ...

ForeverInject International Holdings CO. Limited
Site Member

Zhejiang

Buy cheap CJC-1295 without DAC injection with high quality product

Categories:Other Furniture Parts

Telephone:+86-027-50458986

Country/Region:china

CJC-1295 without DAC injection with high quality :Peptides :645 :2017-03-30 CJC-1295 is a synthetic GHRH analog that selectively and covalently binds to endogenous albumin after ...

Wuhan Demeikai Biotechnology Co.,Ltd
ICP Remarked Supplier

Buy cheap CJC-1295 , CJC1295 | Peptide - Forever-Inject.cc Online Store | 2mg product

Place of Origin:China

Brand Name:Forever-Inject.cc

Model Number:2mg

CJC-1295 other name MOD GRF 1-29 is a long acting GHRH analog for growth hore.Various experiments have been conducted to test the effectiveness of CJC-1295 in vivo and dose...

ForeverInject International Holdings CO. Limited
Site Member

Zhejiang

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request