Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category
Home > Chemicals > Inorganic Acid >

Cjc 1295 Half Life

cjc 1295 half life

All cjc 1295 half life wholesalers & cjc 1295 half life manufacturers come from members. We doesn't provide cjc 1295 half life products or service, please contact them directly and verify their companies info carefully.

Total 2294 products from cjc 1295 half life Manufactures & Suppliers
Quality  for sale

Brand Name:Pharm

Model Number:hannah@chembj.com

Place of Origin:whatsapp: +86 138 7101 4054

... is identical but the difference between the two peptides are the span of the half-life. Modified GRF 1-29 and Sermorelin have a very short acting half-life of about 30 minutes, while CJC-1295 DAC has a

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Hubei

Quality  for sale

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Quality  for sale

Brand Name:YIHAN

Model Number:Cjc-1295

Place of Origin:China

... Peptide Cjc 1295 Without Dac 2 mg/Via CAS 863288-34-0 Detailed Product Description Product Name: Cjc-1295 Without Dac Appearance: Lyophilized powder CAS NO.: 307297-39-8 Purity: 99% Alias: Cjc-1295 Application: Peptide Drum Alias: CJC-1295 Acetate...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Quality  for sale

Brand Name:Pharmlab

Model Number:863288-34-0

Place of Origin:China

... Growth Steroid Cjc-1295 with Dac For Muscle Enhance Quick Detail Products Name: CJC 1295 CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: White Powder Alias: CJC-1295 Acetate...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Quality  for sale

Brand Name:CJC-1295 Without DAC

Model Number:863288-34-0

Place of Origin:China

... the two peptides are the span of the half-life. Modified GRF 1-29 and Sermorelin have a very short acting half-life of about 30 minutes, while CJC-1295 DAC has a half-life that can last up to approximately 8

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Quality  for sale

Brand Name:Fulu

Model Number:863288-34-0

Place of Origin:China

...Growth Hormone Peptides CJC 1295 Without DAC 2mg/vial CAS 2mg/vial Alias CJC-1295 Acetate; CJC1295(Without DAC); CAS No 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.3 Purity (...

SuZhou FuLu Biotech Co.,Ltd
Verified Supplier

Jiangsu

Quality  for sale

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial 1. CJC 1295 DOSES Modified GRF 1-29(cjc1295 w/o DAC): Dose per injection: 100mcg Injections per vial: 20 x 100mcg ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Quality  for sale

Brand Name:yuancheng

Model Number:863288-34-0

Place of Origin:China

...-Ser-Arg-Lys(Maleimidopropionyl)-NH2 CJC-1295 (DAC) contains 30 amino acids. The modified version of GRF 1-29 demonstrates a high affinity towards GHRH receptors. The molecular weight of CJC-1295 (DAC) is 3647.28...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Quality  for sale

Model Number:863288-34-0

...Human Growth Peptides CJC-1295 CAS 863288-34-0 for Lean Body Mass CJC-1295 promotes lean body mass, muscle gain and strength. CJC 1295 is a long acting GHRH analog. Growth-hormone-releasing hormone (GHRH), is also...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hongkong

Quality  for sale

Brand Name:Sendi

Model Number:Pharmaceutical Grade

Place of Origin:China

... Name CJC-1295 With DAC Chemical Name CJC-1295 DAC CAS Number 863288-34-0 Molecular Formula C165H269N47O46 Molecular Weight 873.01 Specification 2mg/10vials/kit Assay 99.5% Appearance White powder CJC-1295 With DAC Description CJC-1295 is...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Quality  for sale

Brand Name:steriodshow

Model Number:CJC-1295 Without DAC (2mg/vial)

Place of Origin:china manufactuer

...; Re-send policy; Door-to-Door; 5% discount for second same order. Quick Detail: Product Name CJC-1295 Without DAC Synonyms CJC-1295 Acetate;CJC-1295; CJC

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Quality  for sale

Brand Name:Biofriend

Model Number:863288-34-0

Place of Origin:Wuhan

...Hormone Peptides Cjc-1295 with Dac for Bodybuilder Health Supplement CAS 863288-34-0 Quick Detail : Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Quality  for sale

Brand Name:JNJG

Model Number:863288-34-0

Place of Origin:CHINA

...2mg Lyophilized Peptide Powder CJC 1295 Without DAC CAS 863288-34-0 Product Name CJC 1295 Without DAC Synonyms CJC1295;CJC-1295 Acetate;CJC1295 with out DAC CAS NO 863288-34-0 MF C159H258N46O45 MW 3649.30 Appearance...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Quality  for sale

Brand Name:HKYC

Model Number:PEPTIDE POWDER

Place of Origin:HUBEI,CHINA

...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality  for sale

Brand Name:HBU

Model Number:51753-57-2

Place of Origin:CHINA

...99% Purity Cjc-1295 with Dac for Fat Burning 2mg / Vial Cjc-1295 with Dac Cjc-1295 with Dac CAS:51753-57-2 Other Name:Grf 1-29 Purity (HPLC):98% MF: C165H271N47O46 MW: ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality  for sale

Brand Name:ChineseHormone

Model Number:863288-34-0

Place of Origin:China

...Quick detail: CAS No.:863288-34-0 Chemical Name: CJC-1295 without DAC Formula:C152H252N44O42 One Letter Sequence:Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 Three Letter Sequence:H-Tyr-D-Ala-Asp-...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Quality  for sale

Brand Name:Shanghai Stero

Model Number:CJC-1295 DAC

Place of Origin:Shanghai

... (also called CJC-1295 without DAC or simply CJC-1295) half life is around 30 minutes, it’s used to provide rapid spikes of GH at the right times. MOD GRF 1-29 = CJC-1295 without DAC CJC-1295 DAC half life is around...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Quality  for sale

Brand Name:Ycphar

Model Number:863288-34-0

Place of Origin:China

...CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC Quick Detail of CJC 1295 Product name CJC-1295 without DAC Synonyms Mod GRF 1-29, CJC-1295 no DAC Sequence Tyr-D-Ala-Asp-Ala-Ile...

Wuhan Yuancheng Technology Development Co., Ltd.
Verified Supplier

Hubei

Quality  for sale

Brand Name:YUANYANG

Model Number:863288-34-0

Place of Origin:China

...Muscle Building CJC-1295 Synthetic GHRH 2 mg/vial Peptides CJC-1295 DAC CAS 863288-34-0 Abstract CJC-1295 DAC has shown some amazing results as a hormone releasing hormone (GHRH) analog. Not only has CJC-1295 shown the ability...

Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Quality  for sale

Brand Name:N/A

Model Number:CJC 1295

Place of Origin:China

...Protuct Name CJC 1295 Appearance white power Molecular Formula C152H252N44O42 Place of Origin China (Mainland) Function bodybuilding, anti-aging ...

Zhongweiye Biological Technology
Site Member

Hebei

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request