Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category
Home > Others > Supplies and Equipment >

Cjc 1295 Half Life

cjc 1295 half life

All cjc 1295 half life wholesalers & cjc 1295 half life manufacturers come from members. We doesn't provide cjc 1295 half life products or service, please contact them directly and verify their companies info carefully.

Total 2782 products from cjc 1295 half life Manufactures & Suppliers
Quality Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 for sale

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Quality Muscle Building CJC-1295 Synthetic GHRH 2 mg/vial Peptides CJC-1295 DAC CAS 863288-34-0 for sale

Brand Name:TINGYI

Model Number:863288-34-0

Place of Origin:CHINA

...Muscle Building CJC-1295 Synthetic GHRH 2 mg/vial Peptides CJC-1295 DAC CAS 863288-34-0 Abstract CJC-1295 DAC has shown some amazing results as a hormone releasing hormone (GHRH) analog. Not only has CJC-1295 shown the ability...

Chongqing Tingyi Biotechnology Co.,Ltd
Verified Supplier

Chongqing

Quality Top Quality Peptide Powder 2mg CJC-1295 For Muscle Gain CAS 863288-34-0 for sale

Brand Name:JNJG

Model Number:CAS 863288-34-0

Place of Origin:CHINA

... 2mg CJC-1295 For Muscle Gain CAS 863288-34-0 Quick Detail Product Name CJC-1295 Acetate Alias CJC-1295 CAS 863288-34-0 Purity 98% Storage Shading, Confined Preservation Grade Pharmaceutical Grade Appearance White Powder CJC-1295 Effect CJC-1295 is...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Quality Weight Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial 863288-34-0 for sale

Brand Name:Sendi

Model Number:CJC-1295 With DAC

Place of Origin:China

... Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial 863288-34-0 2mg/vial $15/vial MOQ: 10 vials 10 vials -- $150 100 vials -- $1200 Shipping cost: $50 What is CJC-1295? 1. Cjc-1295 is also...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Quality Injectable Peptides Supplements Bodybuilding CJC-1295 2mg / Vial For Performance Enhancement for sale

Brand Name:LSW

Model Number:CJC-1295 2mg / Vial

Place of Origin:China

..., if you visit your favorite peptide company’s internet site, you will notice that there is a CJC-1295 with, and another one without DAC. Logically, you will ask yourself - what are the differences...

Wuhan Lianshangwang Technology Co.,Ltd
Verified Supplier

Hubei

Quality CJC - 1295 Acetate Nandrolone Steroid No DAC 2mg / Vial For Bodybuilding for sale

Brand Name:purity

Model Number:863288-34-0

Place of Origin:chiha

... 863288-34-0CJC-1295 Alias: CJC-1295 Acetate; CJC1295(Without DAC) Cas No.: 863288-34-0 Molecular Formula: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% CJC-1295 DAC vs. CJC-1295 No DAC CJC-1295 DAC and CJC-1295 (also known...

Zhuzhou Yuancheng Hezhong Technology Development Co., Ltd.
Verified Supplier

Hunan

Quality Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial for sale

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial 1. CJC 1295 DOSES Modified GRF 1-29(cjc1295 w/o DAC): Dose per injection: 100mcg Injections per vial: 20 x 100mcg ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Quality High Quality Human Peptides 51753-57-2 2mg/Vial Cjc-1295 with Dac for Weight Loss for sale

Brand Name:HongKong Blue

Model Number:Cjc-1295 with DAC

Place of Origin:CHINA

...High Quality Peptide 51753-57-2 2mg/Vial Cjc-1295 with Dac for Weight Loss Basic Info Producing Country: China Wholesale: Yes Mgf Specification: 2mg/...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality Human Growth Peptide Powder Cjc-1295(No Dac) For Boosts Muscle Mass for sale

Brand Name:HKYC

Model Number:muscle building

Place of Origin:HUBEI,CHINA

... Skype:live:kathelin_4 WhataApp:+8618872220706 What is cjc-1295? 1. Cjc-1295 is also referred to as Mod GRF 1-29, which in most cases is recommended to exceed CJC-1295. The duration of the effect of the...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality CJC 1295 Without DAC Growth Hormone Peptides White Lyophilized Peptide HGH CJC-1295 Dosage Benefits for sale

Brand Name:Yvonne

Model Number:863288-34-0

Place of Origin:China

... available at any time; Prompt shipment after payment confirmed; Re-send policy; Door-to-Door CJC 1295 Quick Detail: Product Name CJC-1295 Without DAC Synonyms CJC-1295 Acetate;CJC-1295; CJC-1295 No DAC, CJC

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Quality CJC-1295 with DAC Anti Aging CJC-1295 Peptide Hormones Acetate Growth Steroid for sale

Brand Name:steriodshow

Model Number:863288-34-0

Place of Origin:china manufactuer

...Polypeptide Hormones CJC-1295 with DAC Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Quality Injectable Anabolic Steroids Peptide CJC-1295 DAC  With DAC Lyophilized Powder for sale

Brand Name:Kafen

Model Number:863288-34-0

Place of Origin:China

...Sell High Quality Injectable Anabolic Steroids Peptide CJC-1295 DAC With DAC Lyophilized Powder Basic Info. other name: CJC1295dac, CJC1295withDAC Product Description: CJC-1295 2mg/Vial Type: Immune Function AgentsGrade Standard: Medicine Grad ...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Quality Bodybuilding Human Growth Hormone Peptide Cjc 1295 with Dac CAS 863288-34-0 for sale

Brand Name:Biofriend

Model Number:863288-34-0

Place of Origin:Wuhan

...Hormone Peptides Cjc-1295 with Dac for Bodybuilder Health Supplement CAS 863288-34-0 Quick Detail : Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Quality Powerful CJC 1295 With Dac Growth Hormone Peptide 2mg For Lean Muscles for sale

Brand Name:Pharmlab

Model Number:CJC 1295

Place of Origin:China

...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: Lyophilized powder Single...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Quality Powdered CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 for sale

Brand Name:HKYC

Model Number:863288-34-0

Place of Origin:China

...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile-Phe...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Quality CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 for sale

Brand Name:Muscle Man

Model Number:863288-34-0

Place of Origin:Hunan,China

...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Quality Supply high quality Bodybuilding Muscle Mass Weight Loss Powder CJC-1295 CAS: 863288-34-0 for sale

Brand Name:nanjian

Model Number:863288-34-0

Place of Origin:China

... E-mail: gl04@yccreate.com Supply high quality Bodybuilding Muscle Mass Weight Loss Powder CJC-1295 CAS: 863288-34-0 1.Product Details CJC-1295(2mg,5mg,10mg) 98% Synonyms:CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl...

Zhuhai Shuangbojie Technology Co.,Ltd
Active Member

Guangdong

Quality CJC-1295 Peptide CJC-1295 DAC 2mg/vial White Solid With High Purity For Muscle Building for sale

Brand Name:YH

Model Number:/

Place of Origin:CHINA

...CJC-1295 Peptide CJC-1295 DAC 2mg/vial White Solid With High Purity For Muscle Building Email: jermy@chembj.com ...

Zhongshan Latterson Bio-Pharmaceutical Technology Co.,Ltd
Active Member

Quality Top Quality CJC-1295 With Dac Fat Loss Growth Hormone safe pass for sale

Brand Name:Latterson

Model Number:2922199090

Place of Origin:China

...Top Quality CJC-1295 With Dac Fat Loss Growth Hormone safe pass Basic Info Product name CJC-1295 with DAC CAS register number 863288-34-0 Molecular formula C165H271N47O46 Molecular weight 3649.30 Assay ...

Zhongshan Latterson Biotechnology Co., Ltd.
Active Member

Quality GMP Certified Peptide Steroid Hormones Cjc 1295 with Dac Raw Hormone Powders for sale

Brand Name:Gear steroids

Model Number:1045-69-8

Place of Origin:China

...GMP Certified Peptide Steroid Hormones Cjc 1295 with Dac Raw Hormone Powders CJC-1295 Peptide Profile CJC-1295 is an injectable peptide used to increase GH production. This peptide is a growth hormone releasing ...

Shanghai Rong Can Science And Technology Co., Ltd.
Active Member

Shanghai

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request