Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category
Home > Automobiles & Motorcycles > Steering System >

Cjc 1295 Ghrp 6 Dosage

cjc 1295 ghrp 6 dosage

All cjc 1295 ghrp 6 dosage wholesalers & cjc 1295 ghrp 6 dosage manufacturers come from members. We doesn't provide cjc 1295 ghrp 6 dosage products or service, please contact them directly and verify their companies info carefully.

Total 5658 products from cjc 1295 ghrp 6 dosage Manufactures & Suppliers
Quality Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 for sale

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Quality Weight Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial 863288-34-0 for sale

Brand Name:Sendi

Model Number:CJC-1295 With DAC

Place of Origin:China

... Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial 863288-34-0 2mg/vial $15/vial MOQ: 10 vials 10 vials -- $150 100 vials -- $1200 Shipping cost: $50 What is CJC-1295? 1. Cjc-1295 is also...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Quality Injectable Peptides Supplements Bodybuilding CJC-1295 2mg / Vial For Performance Enhancement for sale

Brand Name:LSW

Model Number:CJC-1295 2mg / Vial

Place of Origin:China

..., if you visit your favorite peptide company’s internet site, you will notice that there is a CJC-1295 with, and another one without DAC. Logically, you will ask yourself - what are the differences...

Wuhan Lianshangwang Technology Co.,Ltd
Verified Supplier

Hubei

Quality 5mg/vial Protein Peptide Hormones 100% Safe DHL to USA CJC 1295 with Dac for sale

Brand Name:Bodybiological

Model Number:CJC 1295 with Dac

Place of Origin:Hubei, China

...-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Quality White Lyophilized Peptides 2mg CJC 1295 Without DAC CAS 863288-34-0 for sale

Brand Name:Nanjian

Place of Origin:China

...White Lyophilized Peptides 2mg CJC 1295 Without DAC CAS 863288-34-0​ Quick Detail: Product Name CJC-1295 Synonym CJC-1295 Acetate; CJC1295(Without DAC) CAS NO 863288-34-0 Molecular Formula C165H271N47O46 Molecular weight 3649.30...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Quality Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0 for sale

Brand Name:HKYC

Model Number:muscle building

Place of Origin:HUBEI,CHINA

... know I will give info.in details. kathelin@yccreate.com Skype:live:kathelin_4 WhataApp:+8618872220706 Description 1.CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a releasing hormone (GHRH) analog.One...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality Powerful CJC 1295 With Dac Growth Hormone Peptide 2mg For Lean Muscles for sale

Brand Name:Pharmlab

Model Number:CJC 1295

Place of Origin:China

...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: Lyophilized powder Single...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Quality CJC 1295 Without DAC Growth Hormone Peptides White Lyophilized Peptide HGH CJC-1295 Dosage Benefits for sale

Brand Name:Yvonne

Model Number:863288-34-0

Place of Origin:China

...CJC 1295 Without DAC 2mg/vial White Lyophilized Peptide HGH CJC-1295 Dosage Benefits Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest price ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Quality CJC-1295 with DAC Anti Aging CJC-1295 Peptide Hormones Acetate Growth Steroid for sale

Brand Name:steriodshow

Model Number:863288-34-0

Place of Origin:china manufactuer

...Polypeptide Hormones CJC-1295 with DAC Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Quality Long - half Life Human Peptide 2mg/vial CJC-1295 Dac Injury Recovery Cellular Repair for sale

Brand Name:Hong Kong Blue

Model Number:CJC 1295 DAC

Place of Origin:China

.../vial CJC-1295 Dac Injury Recovery Cellular Repair **Welcome your inquiry , gift is ready for you----Avril ** 1.Quick detail : Product Name: CJC-1295 DAC Unit size: 2 mg/vial CAS NO.: 863288-34-0 Synonyms: CJC-1295 DAC, CJC 1295...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality Injectable Anabolic Steroids Peptide CJC-1295 DAC  With DAC Lyophilized Powder for sale

Brand Name:Kafen

Model Number:863288-34-0

Place of Origin:China

...Sell High Quality Injectable Anabolic Steroids Peptide CJC-1295 DAC With DAC Lyophilized Powder Basic Info. other name: CJC1295dac, CJC1295withDAC Product Description: CJC-1295 2mg/Vial Type: Immune Function AgentsGrade Standard: Medicine Grad ...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Quality Powdered CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 for sale

Brand Name:HKYC

Model Number:863288-34-0

Place of Origin:China

...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile-Phe...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Quality Injectable Muscle Building Peptides Bodybuilding CJC 1295 Without DAC 863288-34-0 for sale

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99.19% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Quality Bodybuilding Peptides Mix Ghrp-6 (1mg) plus Ipamorelin (1mg) plus Cjc 1295 (1mg) plus Mgf (500mcg) for sale

Brand Name:Biofriend

Model Number:87616-84-0

Place of Origin:China

...Bodybuilding Peptides Mix Ghrp-6(1mg) plus Ipamorelin(1mg) plus Cjc 1295(1mg) plus Mgf(500mcg) Prohormones Steroids Basic Information for GHRP-6 Synonyms: GHRP-6 CAS NO: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Quality 99% Purity Mass-Gains Injectable Peptides Cjc 1295 No Dac ( CJC-1295 without Dac ) for sale

Brand Name:Bodybuilding

Model Number:CJC-1295

Place of Origin:China

...99% Purity Mass-Gains Injectable Peptides Cjc 1295 No Dac (CJC-1295 without Dac) Basic Information for CJC-1295 without DAC Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Quality CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 for sale

Brand Name:Muscle Man

Model Number:863288-34-0

Place of Origin:Hunan,China

...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Quality Muscle Buidling Injectable 99% Purity Human Growth Peptides CJC-1295 DAC 2mg Per Vial for sale

Brand Name:ChineseHormone

Model Number:863288-34-0

Place of Origin:China

... Function: Bodybuilding, Burning Fat Storage Temperature: 2-8 Celsius degree Shelf life: 24 Months in proper storage CJC-1295 DAC Information: CJC-1295 DAC and CJC-1295 (known as Modified GRF 1-29)

Hengyang Desen Biotechnology Co., Ltd.
Verified Supplier

Hunan

Quality 99% Assay Protein Peptide Hormones GHRP-2 For Fat Loss Muscle Gain Safe Pass for sale

Brand Name:Latterson

Model Number:2922199090

Place of Origin:China

... 24hours After Your Payment Payment: Western Union, T/T, Money Gram, Bitcoin Origin: China Export Markets: Global GHRP-2 Description: GHRP-2 and

Zhongshan Latterson Biotechnology Co., Ltd.
Active Member

Quality CJC-1295 Acetate Cas : 863288-34-0 HGH Human Growth Hormone 2mg or 5mg with Safety Shipping for sale

Brand Name:SHUCHAN

Model Number:863288-34-0

Place of Origin:wuhan

keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

ShangHai ShuCan Industrial Co,.LTD
Active Member

Shanghai

Quality Bodybuilding Acetate 98% Peptide CJC 1295 DAC White Powder CAS 863288-34-0 for sale

Brand Name:CJC-1295 DAC

Model Number:CAS Number 863288-34-0

Place of Origin:China

...Bodybuilding Acetate 98% CJC-1295 DAC White Powder Peptide CAS 863288-34-0 Quick details CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone Releasing Hormones (GHRH). Their action ...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request