Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category
Home > Chemicals > Adhesives & Sealants >

Cjc 1295 Ghrp 6 Dosage

cjc 1295 ghrp 6 dosage

All cjc 1295 ghrp 6 dosage wholesalers & cjc 1295 ghrp 6 dosage manufacturers come from members. We doesn't provide cjc 1295 ghrp 6 dosage products or service, please contact them directly and verify their companies info carefully.

Total 3930 products from cjc 1295 ghrp 6 dosage Manufactures & Suppliers
Quality  for sale

Brand Name:purity

Model Number:158861-67-7

Place of Origin:china

...99% Injectable Human Peptide Hormones Bodybuilding Ghrp-2 For Muscle Growth GHRP-2 Alias: GHRP-2 Acetate; (DES-ALA3)-GROWTH E-RELEASING PEPTIDE-2 CAS: 158861-67-7 M.F.: C45H55N9O6 M.W.: 818.0 Purity : 99%min. Appearance: ...

Zhuzhou Yuancheng Hezhong Technology Development Co., Ltd.
Verified Supplier

Hunan

Quality  for sale

Brand Name:Yuancheng

Model Number:863288-34-0

Place of Origin:Wuhan,Hubei

...CJC-1295 Raw Human Growth Peptides CJC-1295 without DAC for muscle growth Products Name; CJC 1295 CAS: 863288-34-0 Molecular Formula: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: White powder Alias: CJC-1295 Acetate; CJC1295...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Quality  for sale

Brand Name:JNJG

Model Number:CJC-1295 with DAC

Place of Origin:CHINA

...CJC 1295 DAC Peptide Steroid Hormones , Medicine Grade Human Growth Peptides Ghrh​ other name CJC1295dac, CJC1295withDAC Product Description CJC-1295 2mg/Vial Type Immune Function AgentsGrade Standard Medicine Grad Classification Brassinosteroid MF ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Quality  for sale

Brand Name:Pharmlab

Model Number:CJC 1295

Place of Origin:China

...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: Lyophilized powder Single...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Quality  for sale

Brand Name:Hong Kong Blue

Model Number:CJC 1295 DAC

Place of Origin:China

.../vial CJC-1295 Dac Injury Recovery Cellular Repair **Welcome your inquiry , gift is ready for you----Avril ** 1.Quick detail : Product Name: CJC-1295 DAC Unit size: 2 mg/vial CAS NO.: 863288-34-0 Synonyms: CJC-1295 DAC, CJC 1295...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality  for sale

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Quality  for sale

Brand Name:ChineseHormone

Model Number:CAS 863288-34-0

Place of Origin:China

...Peptide CJC 1295 Without DAC Growth Hormone Releasing Hormone For Weight Loss Quick View: CJC 1295 without DAC is a 30 amino acid peptide hormone, better known in the community as a GHRH (...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Quality  for sale

Brand Name:LSW

Model Number:CAS:863288-34-0

Place of Origin:China

...Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac for Muscle Enhance with reasonable price and safe delivery Product Description Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Quality  for sale

Brand Name:Muscle Man

Model Number:863288-34-0

Place of Origin:China, Hunan

...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Quality  for sale

Brand Name:steroidphar

Model Number:863288-34-0

Place of Origin:China

...CJC-1295 with DAC 2 mg/ vial Growth Hormone Peptides for Muscle Gain CJC 1295 WITH DAC details: Product Name CJC-1295 With DAC Chemical Name CJC-1295 DAC CAS Number 863288-34-0 Molecular Formula C165H269N47O46 Molecular Weight 873...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Quality  for sale

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Injectable Polypeptide CJC 1295 with Dac 2mg.vial Growth Hormone Fat Burning 1. CJC-1295 With DAC Description CJC-1295 is basically a peptide hormone that acts similar to growth hormonereleasing hormones (GHRH). Invented by a Canadian ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Quality  for sale

Brand Name:Gear Steroids

Model Number:87616-84-0

Place of Origin:China

...-0 Customized: Customized Suitable for: Adult Purity: >99% Cjc-1295 Without Dac Other Name: Cjc-1295 Without Dac Cjc-1295 Without Dac CAS: 87616-84-0 Cjc-1295 Without Dac MW: 873.01 Cjc-1295 Without Dac Appearance: White Lyophilized Powder Specification...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Quality  for sale

Brand Name:CJC-1295

Model Number:CAS Number 863288-34-0

Place of Origin:China

...99% Healthy Anti Aging Hormones Acetate Growth Hormone CAS 863288-34-0 Peptide CJC-1295 2mg Detailed Product Description Product Name CJC-1295 Specification 2mg/vial, 10 vials/kit Category Peptide Shipping Method EMS, HKEMS...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Quality  for sale

Categories:Growth Hormone Peptides

Country/Region:china

... foil bag /box Delivery Detail: receive the payment in 1-2 days Product Description GHRP-6 Acetate Polypeptide Hormones Peptide-6 for bodybuilding GHRP-6 is an injectable peptide in the category of growth hormone releasing peptides...

Kirobiotech Co., Ltd
ICP Remarked Supplier

Quality  for sale

Place of Origin:jiangsu

Brand Name:hugerawsales06@hotmail.com

Model Number:skype:live:hugerawsales06

...Detailed Product Description Ipam Ipamorelin Peptide CJC-1295 DAC Sermorelin USP Peptides For Bodybuilding Quick detail Ipamorelin Alias: Ipamorelin Acetate,Ipamorelin,IPAM, NNC-...

Hugeraw Health Technology Co.,Ltd
Active Member

Jiangsu

Quality  for sale

Brand Name:SHUCHAN

Model Number:863288-34-0

Place of Origin:wuhan

keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

ShangHai ShuCan Industrial Co,.LTD
Active Member

Shanghai

Quality  for sale

Categories:Growth Hormone Peptides

Country/Region:china

... Content(N%): 80%(by %N) Water Content(Karl Fischer): 6.0% Acetate Content(HPIC): 15.0% Mass Balance: 95.0~105.0% CJC-1295 DAC Description: CJC 1295 with DAC is a powerful growth hormone releasing hormone that can be effectivel

Zhuhaishi Shuangbojie Technology Co., Ltd,
ICP Remarked Supplier

Quality  for sale

Categories:Peptide CJC 1295

Telephone:+8618578209853

Country/Region:china

... Buy CJC-1295 Without DACAlias: CJC-1295 Acetate; CJC-1295(Without DAC) ;Sequence: Tyr-D-Ala-Asp-Ala Previous:CJC-1295 DAC 2mg uk results buy Next:GHRP-2 Peptide Cycle Results uk buy Introduction CJC-1295 Without DAC Alias: CJC-1295 Acetate; CJC-1295...

Zhuhaishi Shuangbojie Technology Co.,ltd
ICP Remarked Supplier

Quality  for sale

Categories:Human Growth Hormone Peptide

Country/Region:china

... For Customs Pass Guaranteed Usage: Pharmaceutical Material CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS...

Zhuzhou Interial Biotechnology Co., Ltd
ICP Remarked Supplier

Quality  for sale

Categories:Human Growth Hormone Peptide

Telephone:+86-755-66601416

Country/Region:china

...99% CJC-1295 with DAC powder E-mail:claire@chembj.com Skype: live:695059711 whats app: +8615527046746 Quick detail What is CJC-1295 With DAC ? CJC-1295 with DAC is a peptide hormone used as a GHRH (growth hormone...

Shenzhen Sendi Biotechnology Co.,Ltd
ICP Remarked Supplier

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request