Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category
Home > Chemicals > Benzene & Derivatives >

Buy Sermorelin Ghrp 6

buy sermorelin ghrp 6

All buy sermorelin ghrp 6 wholesalers & buy sermorelin ghrp 6 manufacturers come from members. We doesn't provide buy sermorelin ghrp 6 products or service, please contact them directly and verify their companies info carefully.

Total 10749 products from buy sermorelin ghrp 6 Manufactures & Suppliers
Buy cheap Ghrp-6 Bodybuilding Prohormones for Muscle man 10mg/Vial 98% High Purity product

Brand Name:Yuancheng

Place of Origin:China

Model Number:steroidchina.com

GHRP-6 (Growth hormone releasing peptide) Ghrp-6 Growth hormone releasing peptide CAS 87616-84-0 Factory Direct English Title: Growth hormone releasing peptide Alias: GROWTH ...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Buy cheap Ghrp 2 Peptide For Muscle Gain 5mg 10mg Vial 158861-67-7 product

Brand Name:JNJG

Model Number:158861-67-7

Place of Origin:CHINA

No Side Effect Peptide Ghrp-2 White Powder 5mg 10mg vial for Muscle Gain Ghrp-2 Specification: Product Name Ghrp-2 Ghrp-2 Alias Ghrp2 Ghrp-2 CAS 158861-67-7 Ghrp-2 MF C45H55N9O6 ...

Jinan  Jiage  Biological Technology Co.,Ltd
Verified Supplier

Shandong

Buy cheap Sermorelin , GHRH , Muscle Growth Polypeptide Hormone CA 86168-78-7 product

Brand Name:yc

Model Number:Sermorelin Acetate

Place of Origin:China

Sermorelin, GHRH, Muscle Growth Polypeptide Hormone, CAS: 86168-78-7 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr...

Wuhan Yuancheng Technology Development Co., Ltd.
Verified Supplier

Hubei

Buy cheap Natural Growth Peptides GHRP-6 Cycle 5mg 10mg For Muscle Gain Peptides product

Brand Name:Guangzhou Huao

Model Number:158861-67-7

Place of Origin:Guangzhou China

Human Growth Peptides GHRP-6 Cycle 5mg 10mg For Muscle Gain Peptides Basic Information for GHRP-6 GHRP-6--CAS NO.: 87616-84-0 GHRP-6--Other title: GHRP-6 GHRP-6--MW: 873.01 GHRP-6-...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Buy cheap 98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building product

Brand Name:Yuancheng

Model Number:86168-78-7

Place of Origin:Wuhan,Hubei

98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building Sermorelin - synthetic version of the peptide hormone GHRH Cas No.: 86168-78-7 Purity (HPLC): ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Buy cheap Pharmaceutical Growth Hormone Peptides GHRP-2 5MG Releasing Peptide For Muscle Gain and Anti Aging product

Brand Name:BestSteroid

Model Number:158861-67-7

Place of Origin:Hubei,China

Growth Hormone Peptides GHRP-2 5MG Releasing Peptide For Muscle Gain and Anti Aging GHRP-2 Basic Info GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate CAS: 158861-67-7 M.F.: C42H50N8O5 M...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Buy cheap Research Chemical 99.9% Human Growth Peptide Powder 10mg/vial Ghrp-6 For Weight Loss product

Brand Name:Muscle Man

Model Number:87616-84-0

Place of Origin:China, Hunan

Research Chemical 99.9% Human Growth Peptide Powder 10mg/vial Ghrp-6 For Weight Loss Quick detail: Ghrp-6 Product Name: GHRP-6 Ghrp-6 Chemical Name: Growth hormon releasing peptide...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Buy cheap Injectable Peptides Steroids Sermorelin 2mg / Vial For Muscle Building 86168-78-7 product

Brand Name:JCJ

Model Number:CAS: 86168-78-7

Place of Origin:China

Injectable Polypeptide Hormones Sermorelin 2mg / Vial for Muscle building Weight Loss Detail Sermorelin - synthetic version of the peptide hormone GHRH Cas No.: 86168-78-7 Purity ...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Buy cheap CAS 87616-84-0 Muscle Growth Peptides Growth Hormone-Releasing Peptide 6 GHRP – 6 product

Brand Name:walk

Model Number:87616-84-0

Place of Origin:China

Muscle Growth Human Growth Peptides Growth Hormone-Releasing Peptide 6 GHRP – 6 European Domestic Delivery Service In order to provide best service for you, we established agency ...

Walk Bio-Tech Co., Ltd.
Verified Supplier

Guangdong

Buy cheap Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 product

Brand Name:Shuangbojie

Model Number:nutrition@chembj.com

Place of Origin:China

Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Buy cheap Muscle Mass Polypeptide Hormones , Ghrp -6 10mg growth hormone releasing peptides product

Brand Name:Ghrp

Model Number:Ghrp 6

Place of Origin:China

Muscle Mass Polypeptide Hormones , Ghrp -6 10mg growth hormone releasing peptides Product name: Growth Hormone Releasing Peptide-6; GHRP6; GHRP 6; Growth Hormone Releasing ...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap Sermorelin Human Peptides 2mg / Vial White Powder for Diagnostic Agent and Improving Sleep With Safe shipping product

Brand Name:HongKong Blue

Model Number:86168-78-7

Place of Origin:China

Sermorelin Human Peptides 2mg / Vial White Powder for Diagnostic Agent and Improving Sleep With Safe Shipping Sermorelin Description: Sermorelin Acetate, also known as GRF 1-29, is ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Buy cheap Safety Pharmacy GHRP-6 Injectable Polypeptide Hormones Steroids product

Brand Name:GHRP-6

Model Number:5mg/vial * 10vials/kit

Place of Origin:China

Safety Pharmacy GHRP-6 Injectable Polypeptide Hormones Steroids Product Name: GHRP-6 Manufacturer: Kigtropin Biotechnology Package: 5mg/vial * 10vials/kit GHRP-6 is an injectable ...

HongKong Biosuper Health Tech. Co., Ltd
Verified Supplier

Hongkong

Buy cheap Safety Pharmacy Peptide GHRP-6 Injectable Polypeptide Hormones Steroids product

Brand Name:GHRP-6

Model Number:5mg/vial * 10vials/kit

Place of Origin:China

Safety Pharmacy Peptide GHRP-6 Injectable Polypeptide Hormones Steroids Product Name: GHRP-6 Manufacturer: Kigtropin Biotechnology Package: 5mg/vial * 10vials/kit GHRP-6 is an ...

HongKong Amgen Biopharm CO.,LTD
Verified Supplier

Hong Kong

Buy cheap White Powder Sermorelin Acetate GRF 1-29 Peptide Hormones Bodybuilding product

Brand Name:LSW

Model Number:CAS:86168-78-7

Place of Origin:China

Rleasing Hormone Polypeptide Lyophilized Powder Sermorelin 2mg with safe delivery and good quality Detail: Product Name: Sermorelin Synonyms: Sermorelin acetate, GRF 1-29 CAS: ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Buy cheap Sermorelin , 2mg , peptide,  Synonyms : Geref , GHRH (1-29) , Forever-Inject.cc product

Brand Name:Forever-Inject

Place of Origin:China

Product Information Product Name | Sermorelin Unit Size | 2mg/vial Sequence | H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp...

ForeverInject International Holdings CO. Limited
Site Member

Zhejiang

Buy cheap GHRP6 ,GHRP-6 g6 5mg | peptide | Growth Hormone Releasing Peptide 6 | Online store Forever-inject.cc product

Brand Name:Forever-Inject.cc

Model Number:5mg

Place of Origin:China

GHRP-6 is a peptide in the growth factor family.Benefits of increased Growth H levels through GHRP6 stimulation include:an increase in strength, muscle mass and body fat loss, ...

ForeverInject International Holdings CO. Limited
Site Member

Zhejiang

Buy cheap Sermorelin Ipamorelin Ghrp-6 CJC-1295 With DAC EU USA Canada Peptides CAS 86168-78-7 product

Place of Origin:Jiang su,Taizhou

Brand Name:Hugeraw

Model Number:hugerawjane@hotmail.com

Detailed Product Description Sermorelin Ipamorelin Ghrp-6 CJC-1295 With DAC EU USA Canada Peptides CAS 86168-78-7 USP Sermorelin, TB500, Cjc-1295, Ghrp-6, Ghrp-2, Mgf, Melanotan ...

Hugeraw Health Technology Co.,Ltd
Active Member

Jiangsu

Buy cheap Muscle Mass Increased Growth Hormone Releasing Peptide Ghrp-6 5mg 10mg product

Brand Name:QA

Model Number:87616-84-0

Place of Origin:Guangzhou,China

Muscle Mass Increased Growth Hormone Releasing Peptide Ghrp-6 5mg 10mg Product name: Growth Hormone Releasing Peptide-6; GHRP6; GHRP 6; Growth Hormone Releasing Hexapeptide ...

Guangzhou Quanao Chemical Co.,Ltd
Active Member

Guangdong

Buy cheap Sermorelin Acetate bodybuilding benefits results product

Categories:Truck Suspension

Telephone:+8618578209853

Country/Region:china

Buyer's Guide Lyophilized Peptides Home>>Lyophilized Peptides >>Sermorelin Acetate bodybuilding benefits results Sermorelin Acetate bodybuilding benefits results Sermorelin ...

Zhuhaishi Shuangbojie Technology Co.,ltd
ICP Remarked Supplier

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request