Sign In | Join Free | My tjskl.org.cn
tjskl.org.cn
Products
Search by Category
Home > Health & Medical > Medical Ware >

Building Blocks Amino Acids

building blocks amino acids

All building blocks amino acids wholesalers & building blocks amino acids manufacturers come from members. We doesn't provide building blocks amino acids products or service, please contact them directly and verify their companies info carefully.

Total 952 products from building blocks amino acids Manufactures & Suppliers
Quality L Glutamic Acid Amino Acid Powder Natural Nutrition Enhancement 56-86-0 for sale

Brand Name:No

Model Number:Food Grade

Place of Origin:China

... 3285 Relative density 1.538 Introduction Glutamic Acid is the original source of L-glutamic acid. L-glutamic acid can be supplied with high quality and best price. Glutamic acid is an acidic amino acid. Glutamate important role in the...

Yi Da Chemical CO.LTD
Verified Supplier

Jiangsu

Quality CAS 74-79-3 Pharmaceutical Intermediates White Raw Powder L(+)-Arginine Amino Acids for sale

Brand Name:Desen Nutrition

Model Number:74-79-3

Place of Origin:China

... EINECS:200-811-1 Product Categories:pharmacetical;chiral;Arginine [Arg, R];Amino Acids;Amino Acids and Derivatives;for Resolution of Acids;Optical Resolution;alpha-Amino Acids;Biochemistry;Synthetic Organic Chemistry;L-Amino Acids;Amino Acids;Nitric Oxide

Hengyang Desen Biotechnology Co., Ltd.
Verified Supplier

Hunan

Quality Professional Nutritional Feed Additives Amino Acids L-Tryptophan CAS 73-22-3 for sale

Brand Name:Nanjian

Model Number:73-22-3

Place of Origin:China

... Type: Feed Grade Amino Acids Color: White Product Description L-tryptophan is an amino acid, a protein building block that can be found in many plant and animal proteins. L-tryptophan is called an "essential" amino acid because the body can...

Wuhan Yuancheng Technology Development Co., Ltd.
Verified Supplier

Hubei

Quality Organic Building Blocks Procainamide Hydrochloride CAS 614-39-1 for Antiarrhythmic for sale

Brand Name:Shuangbojie

Model Number:nutrition@chembj.com

Place of Origin:China

...Organic Building Blocks Procainamide Hydrochloride CAS 614-39-1 for Antiarrhythmic Product Name: Procainamide hydrochloride Synonyms: 4-AMINO-N-[2'-(DIETHYLAMINO)ETHYL]BENZAMIDE HCL;4-AMINO-N-(2-DIETHYLAMINOETHYL)BENZAMIDE HYDROCHLORIDE;4-AMINOBENZOIC ACID...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Quality Amino-PEG2-Azide PEG Linker Contaning an Free Amine Group and a Azido Group for sale

Brand Name:Borenpharm

Model Number:BK02158

Place of Origin:China

... for Long Term Introduction The Amino-PEG2-Azide is used for modifying proteins or surfaces such as beads, nanoparticles and self-assembled monolayers. PEG Azides, a Polyethylene Glycol Building Blocks for PEGylation. It contaians...

Borenpharm Co., Ltd
Verified Supplier

Hubei

Quality ACVR2B 1mg Polypeptide Hormone Myostatin Inhibitor ACE 031 For Building Musclea for sale

Brand Name:HKYC

Model Number:ACE-031

Place of Origin:China

...About ACE-031 Description: 40.5 kDa protein containing 368 amino acid residues of the ActRIIb-hFc recombinant protein. MDAMKRGLCCVLLLCGAVFVSPGASGRGEAETRECIYYNANWELERTN QSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQEC ...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Quality Pharma Raw Powder 2-Amino-6-Methylheptane / DMHA For Fat Loss CAS:543-82-8 for sale

Brand Name:HKYC

Model Number:pharma raws

Place of Origin:HUBEI,CHINA

...I will give info.in details. Product Name:2-Amino-6-Methylheptane Synonyms:1,5-dimethyl-hexylamin;2-Heptanamine, 6-methyl-;2-Heptylamine, 6-methyl-;2-Isooctylamine;2-Methyl-6-aminoheptane;2-Metil-6-amino-eptano;6-Amino-2-methylheptane;6-methyl-2-heptanamin

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality CAS 107-35-7 Pure Taurine Powder 2- Aminoethanesulfonic Acid Sports Nutrition Food Additives for sale

Brand Name:Jiaye

Model Number:P-44

Place of Origin:China

...CAS 107-35-7 Pure Taurine Powder 2- Aminoethanesulfonic Acid Sports Nutrition Food Additives 1. Description 1). Taurine, a kind of nonprotein aminophenol and white acicular crystal, smell-...

Tai'an Jia Ye Biological Technology Co.,Ltd
Verified Supplier

Quality Follistatin 344 315 Muscle Building Peptides Supplements Safest And Effective for sale

Brand Name:YUANYANG

Model Number:Follistatin

Place of Origin:CHINA

... muscle repair process and also improve motor functions. It is is made up of 323 amino acids. It binds directly with activin and acts as an activin antagonist. Follistatin 344 is a selective...

Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Quality Quality Arginine/L-Arginine CAS 74-79-3 Amino acids for Nutrition Supplements for sale

Place of Origin:China

...Quality Arginine/L-Arginine CAS 74-79-3 Amino acids for Nutrition Supplements L-Arginine Information Product name: L-Arginine Other name: L-Arginine base CAS No: 74-...

Hangzhou Mobel Biotechnology Co.,ltd
Active Member

Zhejiang

Quality Croscarmellose Sodium Branched Chain Amino Acid Supplements L-Carnitine Tartrate for sale

Brand Name:4U

Model Number:4U002

Place of Origin:China

...Croscarmellose Sodium Branched Chain Amino Acid Supplements L-Carnitine Tartrate 6000mg premium protein amino per serving size With BCAA fortified Highest quality amino acids with quick absorption Excellent effect for lean muscle growth Supplement Facts ...

Depont Industrial Group Co., Limited
Active Member

Jiangsu

Quality BCAA Amino Acids / Valine Amino Acids For Human Body Muscle Growth for sale

Brand Name:SGP

Model Number:sgpbcaa02

Place of Origin:China

... the human body, amino acids are essential to the synthesis of protein and are often termed as "the building blocks" of proteins. There are around 20 idfferent amino acids whereby 9 of termed essential amino acids that can not...

HUBEI SGP PHARMACEUTICAL CO.,LTD
Active Member

Hubei

Quality bcaa supplement,bcaa powder,branched chain amino acids,branched chain amino acid supplements for sale

Brand Name:Yuhui

Place of Origin:China

...What is Branched Chain Amino Acids? BCAAS Amino acids are the building blocks of protein. Branched chain amino acids (BCAAs) are so called because of their structure, which includes a “side chain” of one carbon ...

XIAN YUHUI BIOTECHNOLOGY CO.,LTD
Site Member

Shaanxi

Quality Amino Acid Derivatives N-Acetyl L Cysteine for medicine for sale

Place of Origin:China

Brand Name:Soleado

Model Number:CAS 616-91-1

...acetyl cysteine comes from the amino acid L-cysteine. Amino acids are the building blocks of proteins. N-acetyl cysteine has many uses as medicine. N-acetyl cysteine is used to counteract ...

WUHAN SOLEADO TECHNOLOGY CO.,LTD.
Active Member

Hubei

Quality CAS 204255-11-8 Chemical Building Blocks Oseltamivir Phosphate for sale

Brand Name:NEW STAR

Model Number:204255-11-8

Place of Origin:CHINA

...CAS 204255-11-8 Chemistry Building Blocks Oseltamivir phosphate product Name Oseltamivir phosphate Synonyms (3R,4R,5S)-4-Acetamido-5-amino-3-(1-ethylpropoxy)-1-cyclohexene-1-carboxylic acid ethyl ester phosphate (1:1); Oseltamivirphosphate Molecular ...

Newstar Chemical Co. Ltd
Active Member

Jiangsu

Quality Plant Extracts Creatine  99.5% Health Lean Muscle Raw Steroid Powders CAS 57-00-1 for Bodybuilding and Muscle Gain for sale

Brand Name:CAS 57-00-1

Model Number:CAS 57-00-1

Place of Origin:China

...-00-1 Prohormone Creatine For Muscle Building Quick Detail: Product Name: Creatine Synonyms: LABOTEST-BB LT00566114;CREATINE;METHYL GLYCOCYAMINE;ALPHA-METHYLGUANIDO]ACETIC ACID;(A-METHYLGUANIDO)ACETIC ACID;N-GUANYL-N-METHYLGLYCINE;N-METHYL-N-GUANYLGLYCINE...

Guangzhou Strong Power Trading Co.,Ltd
Site Member

Guangdong

Quality 56-85-9 Assay 99% White Crystals L-Glutamine amino acid used by white blood cells for sale

Place of Origin:Shanghai

Brand Name:xintais

...56-85-9 Assay 99% White Crystals L-Glutamine amino acid used by white blood cells Detailed Product Description 1.enhance brain and cognitive function 2.CAS 56-...

Shanghai Xintais Chemicals Co., Ltd.
Active Member

Jiangsu

Quality Amino Acid 33%, 45%, 50% animal origin for sale

Place of Origin:China

Brand Name:X-Y BIO

...Amino acids are organic compounds that combine to form proteins. Amino acids and proteins are the building blocks of life. Product Specification ITEMS STANDARDS Product Name Amino Acid powder animal origin 33% Amino Acid powder animal origin 45% Amino Acid...

Hangzhou Xiao-Yi Biotechnology Co., Ltd (X-YBio)
Active Member

Zhejiang

Quality Amino Acids And Vitamin Food Grade Amino Acids for sale

Categories:Food Additives

Telephone:+86-571-28021283

Country/Region:china

... by Sea L-Arginine Pictures Quality Report of L-Arginine Description of L-Arginine L-arginine is a chemical building block called an amino acid.” It is obtained from the diet and is necessary for the body to make...

Hangzhou Mobel Biotechnology Co., Ltd
ICP Remarked Supplier

Quality L-Prolinamide 95% Purity API-Active Pharmaceutical Ingredients Amino Acid CAS 7531-52-4 for sale

Brand Name:HZ

Model Number:CAS 7531-52-4

Place of Origin:China

...-2-CARBOXYLIC ACID AMIDE;(S)-PROLINAMIDE;H-PRO-NH2;L-PROLINE AMIDE;L-(-)-PROLINAMIDE;L-PROLINAMIDE CAS: 7531-52-4 MF: C5H10N2O MW: 114.15 EINECS: 231-397-0 Product Categories: AMINOACIDS DERIVATIVES;APIs;Amino Acids;Proline [Pro, P];Amino Acids and...

Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
Active Member

Hubei

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request